Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 76734..76998 | Replicon | plasmid pEC974-1 |
Accession | NZ_CP021841 | ||
Organism | Escherichia coli strain EC974 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | CDH88_RS26635 | Protein ID | WP_001387489.1 |
Coordinates | 76846..76998 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 76734..76794 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDH88_RS26610 | 72326..72643 | + | 318 | WP_000118520.1 | quaternary ammonium compound efflux SMR transporter SugE | - |
CDH88_RS26615 | 72640..73173 | - | 534 | WP_001221666.1 | lipocalin family protein | - |
CDH88_RS26620 | 73267..74412 | - | 1146 | WP_063859698.1 | class C beta-lactamase CMY-111 | - |
CDH88_RS26625 | 74736..75998 | - | 1263 | WP_000608644.1 | IS1380-like element ISEc9 family transposase | - |
CDH88_RS28350 | 76184..76531 | - | 348 | Protein_90 | protein finQ | - |
- | 76734..76794 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 76734..76794 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 76734..76794 | - | 61 | NuclAT_0 | - | Antitoxin |
- | 76734..76794 | - | 61 | NuclAT_0 | - | Antitoxin |
CDH88_RS26635 | 76846..76998 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
CDH88_RS26640 | 77070..77321 | - | 252 | WP_001291964.1 | hypothetical protein | - |
CDH88_RS26645 | 77621..77917 | + | 297 | WP_011264046.1 | hypothetical protein | - |
CDH88_RS28565 | 77982..78158 | - | 177 | WP_001054897.1 | hypothetical protein | - |
CDH88_RS26650 | 78550..78759 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
CDH88_RS26655 | 78831..79493 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
CDH88_RS26660 | 79564..81732 | - | 2169 | WP_023518847.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | ant(3'')-Ia / aac(3)-IId / blaCMY-111 | - | 1..118934 | 118934 | |
- | flank | IS/Tn | blaCMY-111 | - | 73267..75998 | 2731 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T77614 WP_001387489.1 NZ_CP021841:76846-76998 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T77614 NZ_CP021841:76846-76998 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT77614 NZ_CP021841:c76794-76734 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|