Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 63121..63391 | Replicon | plasmid tig00000856 |
| Accession | NZ_CP021711 | ||
| Organism | Klebsiella pneumoniae strain AR_0143 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | AM390_RS29800 | Protein ID | WP_001312861.1 |
| Coordinates | 63233..63391 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 63121..63184 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM390_RS29770 | 58887..59414 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| AM390_RS29775 | 59472..59705 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| AM390_RS29780 | 59766..61734 | + | 1969 | Protein_66 | ParB/RepB/Spo0J family partition protein | - |
| AM390_RS29785 | 61803..62237 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| AM390_RS29790 | 62234..62953 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 62965..63189 | + | 225 | NuclAT_0 | - | - |
| - | 62965..63189 | + | 225 | NuclAT_0 | - | - |
| - | 62965..63189 | + | 225 | NuclAT_0 | - | - |
| - | 62965..63189 | + | 225 | NuclAT_0 | - | - |
| - | 63121..63184 | - | 64 | - | - | Antitoxin |
| AM390_RS29800 | 63233..63391 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| AM390_RS29805 | 63749..64174 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
| AM390_RS29810 | 64171..64521 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| AM390_RS29815 | 64552..66165 | + | 1614 | WP_000080200.1 | IS66-like element ISEc23 family transposase | - |
| AM390_RS30730 | 66250..66454 | - | 205 | Protein_73 | pilus protein | - |
| AM390_RS29835 | 66846..67142 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| AM390_RS29840 | 67253..68074 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..78638 | 78638 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T77099 WP_001312861.1 NZ_CP021711:63233-63391 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T77099 NZ_CP021711:63233-63391 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT77099 NZ_CP021711:c63184-63121 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|