Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 44941..45205 | Replicon | plasmid tig00001252 |
| Accession | NZ_CP021693 | ||
| Organism | Escherichia coli strain AR_0151 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | AM398_RS25605 | Protein ID | WP_001387489.1 |
| Coordinates | 44941..45093 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 45145..45205 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM398_RS25570 | 40033..40566 | - | 534 | WP_001221666.1 | lipocalin family protein | - |
| AM398_RS25575 | 40660..41805 | - | 1146 | WP_039023136.1 | class C extended-spectrum beta-lactamase CMY-42 | - |
| AM398_RS25580 | 42258..42955 | - | 698 | Protein_47 | IS1 family transposase | - |
| AM398_RS25590 | 43180..43389 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| AM398_RS26165 | 43781..43957 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| AM398_RS25595 | 44022..44318 | - | 297 | WP_011264046.1 | hypothetical protein | - |
| AM398_RS25600 | 44618..44869 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| AM398_RS25605 | 44941..45093 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - | 45145..45205 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 45145..45205 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 45145..45205 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 45145..45205 | + | 61 | NuclAT_0 | - | Antitoxin |
| AM398_RS25610 | 45408..45755 | + | 348 | Protein_53 | protein finQ | - |
| AM398_RS25615 | 45941..47098 | + | 1158 | Protein_54 | IS1380-like element ISEc9 family transposase | - |
| AM398_RS25625 | 47154..47851 | + | 698 | Protein_55 | IS1 family transposase | - |
| AM398_RS25630 | 47865..48170 | - | 306 | Protein_56 | transcription termination factor NusG | - |
| AM398_RS25640 | 48612..48899 | - | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
| AM398_RS25645 | 48817..49080 | - | 264 | WP_032180564.1 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaTEM-1B / blaCMY-42 | - | 1..50228 | 50228 | |
| - | inside | IScluster/Tn | blaCMY-42 | - | 40660..47429 | 6769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T77043 WP_001387489.1 NZ_CP021693:c45093-44941 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T77043 NZ_CP021693:c45093-44941 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT77043 NZ_CP021693:45145-45205 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|