Detailed information of TA system TA077015

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 140347..140586
• Replicon: plasmid tig00007555j7554
• Accession: NZ_CP021690
• Organism: Escherichia coli strain AR_0058

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: AM437_RS26655
• Protein ID: WP_023144756.1
• Coordinates: 140347..140481 (-)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	140526..140586 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AM437_RS26620	136358..136759	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
AM437_RS27130	136692..136949	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
AM437_RS26625	137042..137695	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
AM437_RS26635	138635..139492	-	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
AM437_RS26640	139485..139559	-	75	WP_031943482.1	RepA leader peptide Tap	-
AM437_RS27330	139556..139690	-	135	Protein_169	protein CopA/IncA	-
AM437_RS26650	139796..140050	-	255	WP_000083850.1	replication regulatory protein RepA	-
AM437_RS26655	140347..140481	-	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	140526..140586	+	61	NuclAT_2	-	Antitoxin
-	140526..140586	+	61	NuclAT_2	-	Antitoxin
-	140526..140586	+	61	NuclAT_2	-	Antitoxin
-	140526..140586	+	61	NuclAT_2	-	Antitoxin
AM437_RS27335	140553..140839	-	287	Protein_172	DUF2726 domain-containing protein	-
AM437_RS26665	140917..142530	-	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
AM437_RS26670	142561..142911	-	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
AM437_RS26675	142908..143333	-	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
AM437_RS26685	143892..144104	-	213	WP_013023861.1	hypothetical protein	-
AM437_RS26690	144235..144795	-	561	WP_000139341.1	fertility inhibition protein FinO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / aac(3)-IId / blaTEM-52B	senB	1..163045	163045

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T77015 WP_023144756.1 NZ_CP021690:c140481-140347 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T77015 NZ_CP021690:c140481-140347 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT77015 NZ_CP021690:140526-140586 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin