Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 10999..11241 | Replicon | plasmid tig00007555j7554 |
Accession | NZ_CP021690 | ||
Organism | Escherichia coli strain AR_0058 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | AM437_RS25730 | Protein ID | WP_001312861.1 |
Coordinates | 10999..11157 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 11201..11241 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AM437_RS25690 | 6111..6338 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
AM437_RS25695 | 6426..7103 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
AM437_RS25700 | 7237..7620 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
AM437_RS25705 | 7951..8553 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
AM437_RS25710 | 8850..9671 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
AM437_RS25715 | 9790..10077 | - | 288 | WP_000107535.1 | hypothetical protein | - |
AM437_RS27300 | 10102..10308 | - | 207 | WP_000275859.1 | hypothetical protein | - |
AM437_RS27305 | 10221..10556 | - | 336 | WP_013023876.1 | hypothetical protein | - |
AM437_RS25730 | 10999..11157 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 11201..11241 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 11201..11241 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 11201..11241 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 11201..11241 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 12685..12871 | - | 187 | NuclAT_0 | - | - |
- | 12685..12871 | - | 187 | NuclAT_0 | - | - |
- | 12685..12871 | - | 187 | NuclAT_0 | - | - |
- | 12685..12871 | - | 187 | NuclAT_0 | - | - |
AM437_RS25745 | 12883..13602 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
AM437_RS25750 | 13599..14033 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
AM437_RS25755 | 14088..16046 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / aac(3)-IId / blaTEM-52B | senB | 1..163045 | 163045 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T77009 WP_001312861.1 NZ_CP021690:c11157-10999 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T77009 NZ_CP021690:c11157-10999 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT77009 NZ_CP021690:c11241-11201 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|