Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1280894..1281115 Replicon chromosome
Accession NZ_CP021288
Organism Escherichia coli strain PA45B

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag PA45B_RS06715 Protein ID WP_000170954.1
Coordinates 1280894..1281001 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1281054..1281115 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PA45B_RS06690 1276739..1277821 + 1083 WP_000804726.1 peptide chain release factor 1 -
PA45B_RS06695 1277821..1278654 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
PA45B_RS06700 1278651..1279043 + 393 WP_000200375.1 invasion regulator SirB2 -
PA45B_RS06705 1279047..1279856 + 810 WP_001257054.1 invasion regulator SirB1 -
PA45B_RS06710 1279892..1280746 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
PA45B_RS06715 1280894..1281001 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1281054..1281115 + 62 NuclAT_12 - Antitoxin
- 1281054..1281115 + 62 NuclAT_12 - Antitoxin
- 1281054..1281115 + 62 NuclAT_12 - Antitoxin
- 1281054..1281115 + 62 NuclAT_12 - Antitoxin
- 1281054..1281115 + 62 NuclAT_13 - Antitoxin
- 1281054..1281115 + 62 NuclAT_13 - Antitoxin
- 1281054..1281115 + 62 NuclAT_13 - Antitoxin
- 1281054..1281115 + 62 NuclAT_13 - Antitoxin
- 1281054..1281115 + 62 NuclAT_14 - Antitoxin
- 1281054..1281115 + 62 NuclAT_14 - Antitoxin
- 1281054..1281115 + 62 NuclAT_14 - Antitoxin
- 1281054..1281115 + 62 NuclAT_14 - Antitoxin
- 1281054..1281115 + 62 NuclAT_15 - Antitoxin
- 1281054..1281115 + 62 NuclAT_15 - Antitoxin
- 1281054..1281115 + 62 NuclAT_15 - Antitoxin
- 1281054..1281115 + 62 NuclAT_15 - Antitoxin
- 1281054..1281115 + 62 NuclAT_16 - Antitoxin
- 1281054..1281115 + 62 NuclAT_16 - Antitoxin
- 1281054..1281115 + 62 NuclAT_16 - Antitoxin
- 1281054..1281115 + 62 NuclAT_16 - Antitoxin
- 1281054..1281115 + 62 NuclAT_17 - Antitoxin
- 1281054..1281115 + 62 NuclAT_17 - Antitoxin
- 1281054..1281115 + 62 NuclAT_17 - Antitoxin
- 1281054..1281115 + 62 NuclAT_17 - Antitoxin
- 1281054..1281116 + 63 NuclAT_10 - -
- 1281054..1281116 + 63 NuclAT_10 - -
- 1281054..1281116 + 63 NuclAT_10 - -
- 1281054..1281116 + 63 NuclAT_10 - -
- 1281054..1281116 + 63 NuclAT_11 - -
- 1281054..1281116 + 63 NuclAT_11 - -
- 1281054..1281116 + 63 NuclAT_11 - -
- 1281054..1281116 + 63 NuclAT_11 - -
- 1281054..1281116 + 63 NuclAT_6 - -
- 1281054..1281116 + 63 NuclAT_6 - -
- 1281054..1281116 + 63 NuclAT_6 - -
- 1281054..1281116 + 63 NuclAT_6 - -
- 1281054..1281116 + 63 NuclAT_7 - -
- 1281054..1281116 + 63 NuclAT_7 - -
- 1281054..1281116 + 63 NuclAT_7 - -
- 1281054..1281116 + 63 NuclAT_7 - -
- 1281054..1281116 + 63 NuclAT_8 - -
- 1281054..1281116 + 63 NuclAT_8 - -
- 1281054..1281116 + 63 NuclAT_8 - -
- 1281054..1281116 + 63 NuclAT_8 - -
- 1281054..1281116 + 63 NuclAT_9 - -
- 1281054..1281116 + 63 NuclAT_9 - -
- 1281054..1281116 + 63 NuclAT_9 - -
- 1281054..1281116 + 63 NuclAT_9 - -
- 1281054..1281117 + 64 NuclAT_18 - -
- 1281054..1281117 + 64 NuclAT_18 - -
- 1281054..1281117 + 64 NuclAT_18 - -
- 1281054..1281117 + 64 NuclAT_18 - -
- 1281054..1281117 + 64 NuclAT_19 - -
- 1281054..1281117 + 64 NuclAT_19 - -
- 1281054..1281117 + 64 NuclAT_19 - -
- 1281054..1281117 + 64 NuclAT_19 - -
- 1281054..1281117 + 64 NuclAT_20 - -
- 1281054..1281117 + 64 NuclAT_20 - -
- 1281054..1281117 + 64 NuclAT_20 - -
- 1281054..1281117 + 64 NuclAT_20 - -
- 1281054..1281117 + 64 NuclAT_21 - -
- 1281054..1281117 + 64 NuclAT_21 - -
- 1281054..1281117 + 64 NuclAT_21 - -
- 1281054..1281117 + 64 NuclAT_21 - -
- 1281054..1281117 + 64 NuclAT_22 - -
- 1281054..1281117 + 64 NuclAT_22 - -
- 1281054..1281117 + 64 NuclAT_22 - -
- 1281054..1281117 + 64 NuclAT_22 - -
- 1281054..1281117 + 64 NuclAT_23 - -
- 1281054..1281117 + 64 NuclAT_23 - -
- 1281054..1281117 + 64 NuclAT_23 - -
- 1281054..1281117 + 64 NuclAT_23 - -
PA45B_RS06725 1281407..1282507 - 1101 WP_001313768.1 sodium-potassium/proton antiporter ChaA -
PA45B_RS06730 1282777..1283007 + 231 WP_001146444.1 putative cation transport regulator ChaB -
PA45B_RS06735 1283165..1283860 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
PA45B_RS06740 1283904..1284257 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
PA45B_RS06745 1284442..1285836 + 1395 WP_000086194.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T76406 WP_000170954.1 NZ_CP021288:c1281001-1280894 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T76406 NZ_CP021288:c1281001-1280894 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT76406 NZ_CP021288:1281054-1281115 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References