Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 296847..297068 Replicon chromosome
Accession NZ_CP021207
Organism Escherichia coli strain strain Z247

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag CA270_RS01600 Protein ID WP_001531632.1
Coordinates 296847..296954 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 297002..297068 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CA270_RS01575 292691..293773 + 1083 WP_000804726.1 peptide chain release factor 1 -
CA270_RS01580 293773..294606 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
CA270_RS01585 294603..294995 + 393 WP_086353122.1 invasion regulator SirB2 -
CA270_RS01590 294999..295808 + 810 WP_001257044.1 invasion regulator SirB1 -
CA270_RS01595 295844..296698 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CA270_RS01600 296847..296954 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 297002..297068 + 67 NuclAT_10 - Antitoxin
- 297002..297068 + 67 NuclAT_10 - Antitoxin
- 297002..297068 + 67 NuclAT_10 - Antitoxin
- 297002..297068 + 67 NuclAT_10 - Antitoxin
- 297002..297068 + 67 NuclAT_11 - Antitoxin
- 297002..297068 + 67 NuclAT_11 - Antitoxin
- 297002..297068 + 67 NuclAT_11 - Antitoxin
- 297002..297068 + 67 NuclAT_11 - Antitoxin
- 297002..297068 + 67 NuclAT_6 - Antitoxin
- 297002..297068 + 67 NuclAT_6 - Antitoxin
- 297002..297068 + 67 NuclAT_6 - Antitoxin
- 297002..297068 + 67 NuclAT_6 - Antitoxin
- 297002..297068 + 67 NuclAT_7 - Antitoxin
- 297002..297068 + 67 NuclAT_7 - Antitoxin
- 297002..297068 + 67 NuclAT_7 - Antitoxin
- 297002..297068 + 67 NuclAT_7 - Antitoxin
- 297002..297068 + 67 NuclAT_8 - Antitoxin
- 297002..297068 + 67 NuclAT_8 - Antitoxin
- 297002..297068 + 67 NuclAT_8 - Antitoxin
- 297002..297068 + 67 NuclAT_8 - Antitoxin
- 297002..297068 + 67 NuclAT_9 - Antitoxin
- 297002..297068 + 67 NuclAT_9 - Antitoxin
- 297002..297068 + 67 NuclAT_9 - Antitoxin
- 297002..297068 + 67 NuclAT_9 - Antitoxin
- 297004..297067 + 64 NuclAT_13 - -
- 297004..297067 + 64 NuclAT_13 - -
- 297004..297067 + 64 NuclAT_13 - -
- 297004..297067 + 64 NuclAT_13 - -
- 297004..297067 + 64 NuclAT_14 - -
- 297004..297067 + 64 NuclAT_14 - -
- 297004..297067 + 64 NuclAT_14 - -
- 297004..297067 + 64 NuclAT_14 - -
- 297004..297067 + 64 NuclAT_15 - -
- 297004..297067 + 64 NuclAT_15 - -
- 297004..297067 + 64 NuclAT_15 - -
- 297004..297067 + 64 NuclAT_15 - -
- 297004..297067 + 64 NuclAT_16 - -
- 297004..297067 + 64 NuclAT_16 - -
- 297004..297067 + 64 NuclAT_16 - -
- 297004..297067 + 64 NuclAT_16 - -
- 297004..297067 + 64 NuclAT_17 - -
- 297004..297067 + 64 NuclAT_17 - -
- 297004..297067 + 64 NuclAT_17 - -
- 297004..297067 + 64 NuclAT_17 - -
- 297004..297067 + 64 NuclAT_18 - -
- 297004..297067 + 64 NuclAT_18 - -
- 297004..297067 + 64 NuclAT_18 - -
- 297004..297067 + 64 NuclAT_18 - -
- 297004..297069 + 66 NuclAT_19 - -
- 297004..297069 + 66 NuclAT_19 - -
- 297004..297069 + 66 NuclAT_19 - -
- 297004..297069 + 66 NuclAT_19 - -
- 297004..297069 + 66 NuclAT_20 - -
- 297004..297069 + 66 NuclAT_20 - -
- 297004..297069 + 66 NuclAT_20 - -
- 297004..297069 + 66 NuclAT_20 - -
- 297004..297069 + 66 NuclAT_21 - -
- 297004..297069 + 66 NuclAT_21 - -
- 297004..297069 + 66 NuclAT_21 - -
- 297004..297069 + 66 NuclAT_21 - -
- 297004..297069 + 66 NuclAT_22 - -
- 297004..297069 + 66 NuclAT_22 - -
- 297004..297069 + 66 NuclAT_22 - -
- 297004..297069 + 66 NuclAT_22 - -
- 297004..297069 + 66 NuclAT_23 - -
- 297004..297069 + 66 NuclAT_23 - -
- 297004..297069 + 66 NuclAT_23 - -
- 297004..297069 + 66 NuclAT_23 - -
- 297004..297069 + 66 NuclAT_24 - -
- 297004..297069 + 66 NuclAT_24 - -
- 297004..297069 + 66 NuclAT_24 - -
- 297004..297069 + 66 NuclAT_24 - -
CA270_RS01610 297359..298459 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
CA270_RS01615 298729..298968 + 240 WP_000120702.1 putative cation transport regulator ChaB -
CA270_RS01620 299117..299812 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
CA270_RS01625 299856..300209 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
CA270_RS01630 300394..301788 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T76273 WP_001531632.1 NZ_CP021207:c296954-296847 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T76273 NZ_CP021207:c296954-296847 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT76273 NZ_CP021207:297002-297068 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References