Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 134788..135057 | Replicon | plasmid p1002-1 |
| Accession | NZ_CP021203 | ||
| Organism | Escherichia coli strain Z1002 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | CA268_RS27560 | Protein ID | WP_001312861.1 |
| Coordinates | 134899..135057 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 134788..134853 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CA268_RS27530 | 130498..131025 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| CA268_RS27535 | 131083..131316 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| CA268_RS27540 | 131377..133400 | + | 2024 | Protein_148 | ParB/RepB/Spo0J family partition protein | - |
| CA268_RS27545 | 133469..133903 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| CA268_RS27550 | 133900..134619 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 134631..134855 | + | 225 | NuclAT_0 | - | - |
| - | 134631..134855 | + | 225 | NuclAT_0 | - | - |
| - | 134631..134855 | + | 225 | NuclAT_0 | - | - |
| - | 134631..134855 | + | 225 | NuclAT_0 | - | - |
| CA268_RS30705 | 134640..134819 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 134788..134853 | + | 66 | - | - | Antitoxin |
| CA268_RS27560 | 134899..135057 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| CA268_RS30810 | 135295..135672 | - | 378 | Protein_153 | hypothetical protein | - |
| CA268_RS27580 | 135972..136268 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| CA268_RS27585 | 136379..137200 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| CA268_RS27590 | 137497..138099 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| CA268_RS27595 | 138422..138805 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| CA268_RS27600 | 138999..139670 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| CA268_RS27605 | 139807..140034 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qacE / sul1 / mph(A) / erm(B) / aac(3)-IIa / blaCTX-M-15 / aadA5 | - | 1..183508 | 183508 | |
| - | inside | Integron | qacE / aadA5 / dfrA17 | - | 37..183442 | 183405 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T76262 WP_001312861.1 NZ_CP021203:134899-135057 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T76262 NZ_CP021203:134899-135057 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT76262 NZ_CP021203:134788-134853 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|