Detailed information of TA system TA076221

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 119136..119375
• Replicon: plasmid pEC-81009
• Accession: NZ_CP021180
• Organism: Escherichia coli strain 81009

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: DNNLJILF_RS26700
• Protein ID: WP_023144756.1
• Coordinates: 119241..119375 (+)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	119136..119196 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
DNNLJILF_RS26665	114927..115487	+	561	WP_000139341.1	fertility inhibition protein FinO	-
DNNLJILF_RS26670	115618..115830	+	213	WP_013023861.1	hypothetical protein	-
DNNLJILF_RS26680	116389..116814	+	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
DNNLJILF_RS26685	116811..117161	+	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
DNNLJILF_RS26690	117192..118805	+	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
DNNLJILF_RS26695	118883..119169	+	287	Protein_137	DUF2726 domain-containing protein	-
-	119136..119196	-	61	NuclAT_2	-	Antitoxin
-	119136..119196	-	61	NuclAT_2	-	Antitoxin
-	119136..119196	-	61	NuclAT_2	-	Antitoxin
-	119136..119196	-	61	NuclAT_2	-	Antitoxin
DNNLJILF_RS26700	119241..119375	+	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
DNNLJILF_RS26705	119672..119926	+	255	WP_000083850.1	replication regulatory protein RepA	-
DNNLJILF_RS28020	120032..120166	+	135	Protein_140	protein CopA/IncA	-
DNNLJILF_RS26715	120163..120237	+	75	WP_031943482.1	RepA leader peptide Tap	-
DNNLJILF_RS26720	120230..121087	+	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
DNNLJILF_RS26730	122027..122680	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
DNNLJILF_RS27655	122773..123030	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
DNNLJILF_RS26735	122963..123364	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
DNNLJILF_RS26745	123613..124028	+	416	Protein_146	IS1 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27	senB	1..135720	135720

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T76221 WP_023144756.1 NZ_CP021180:119241-119375 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T76221 NZ_CP021180:119241-119375 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT76221 NZ_CP021180:c119196-119136 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin