Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 119136..119375 | Replicon | plasmid pEC-81009 |
| Accession | NZ_CP021180 | ||
| Organism | Escherichia coli strain 81009 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | DNNLJILF_RS26700 | Protein ID | WP_023144756.1 |
| Coordinates | 119241..119375 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 119136..119196 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DNNLJILF_RS26665 | 114927..115487 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| DNNLJILF_RS26670 | 115618..115830 | + | 213 | WP_013023861.1 | hypothetical protein | - |
| DNNLJILF_RS26680 | 116389..116814 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
| DNNLJILF_RS26685 | 116811..117161 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| DNNLJILF_RS26690 | 117192..118805 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| DNNLJILF_RS26695 | 118883..119169 | + | 287 | Protein_137 | DUF2726 domain-containing protein | - |
| - | 119136..119196 | - | 61 | NuclAT_2 | - | Antitoxin |
| - | 119136..119196 | - | 61 | NuclAT_2 | - | Antitoxin |
| - | 119136..119196 | - | 61 | NuclAT_2 | - | Antitoxin |
| - | 119136..119196 | - | 61 | NuclAT_2 | - | Antitoxin |
| DNNLJILF_RS26700 | 119241..119375 | + | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| DNNLJILF_RS26705 | 119672..119926 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| DNNLJILF_RS28020 | 120032..120166 | + | 135 | Protein_140 | protein CopA/IncA | - |
| DNNLJILF_RS26715 | 120163..120237 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| DNNLJILF_RS26720 | 120230..121087 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| DNNLJILF_RS26730 | 122027..122680 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| DNNLJILF_RS27655 | 122773..123030 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| DNNLJILF_RS26735 | 122963..123364 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| DNNLJILF_RS26745 | 123613..124028 | + | 416 | Protein_146 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..135720 | 135720 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T76221 WP_023144756.1 NZ_CP021180:119241-119375 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T76221 NZ_CP021180:119241-119375 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT76221 NZ_CP021180:c119196-119136 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|