Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 91594..91836 | Replicon | plasmid pEC-81009 |
Accession | NZ_CP021180 | ||
Organism | Escherichia coli strain 81009 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | DNNLJILF_RS26535 | Protein ID | WP_001312861.1 |
Coordinates | 91678..91836 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 91594..91634 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DNNLJILF_RS26510 | 86789..88747 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
DNNLJILF_RS26515 | 88802..89236 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
DNNLJILF_RS26520 | 89233..89952 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
- | 89964..90150 | + | 187 | NuclAT_0 | - | - |
- | 89964..90150 | + | 187 | NuclAT_0 | - | - |
- | 89964..90150 | + | 187 | NuclAT_0 | - | - |
- | 89964..90150 | + | 187 | NuclAT_0 | - | - |
DNNLJILF_RS26530 | 90198..91567 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
- | 91594..91634 | + | 41 | NuclAT_1 | - | Antitoxin |
- | 91594..91634 | + | 41 | NuclAT_1 | - | Antitoxin |
- | 91594..91634 | + | 41 | NuclAT_1 | - | Antitoxin |
- | 91594..91634 | + | 41 | NuclAT_1 | - | Antitoxin |
DNNLJILF_RS26535 | 91678..91836 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
DNNLJILF_RS27865 | 92279..92614 | + | 336 | WP_013023876.1 | hypothetical protein | - |
DNNLJILF_RS26550 | 92527..92733 | + | 207 | WP_000275859.1 | hypothetical protein | - |
DNNLJILF_RS26555 | 92758..93045 | + | 288 | WP_000107535.1 | hypothetical protein | - |
DNNLJILF_RS26560 | 93164..93985 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
DNNLJILF_RS26565 | 94282..94884 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
DNNLJILF_RS26570 | 95215..95598 | + | 384 | WP_001151566.1 | relaxosome protein TraM | - |
DNNLJILF_RS26575 | 95732..96409 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
DNNLJILF_RS26580 | 96497..96724 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..135720 | 135720 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T76217 WP_001312861.1 NZ_CP021180:91678-91836 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T76217 NZ_CP021180:91678-91836 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT76217 NZ_CP021180:91594-91634 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|