Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2108689..2108906 | Replicon | chromosome |
Accession | NZ_CP021178 | ||
Organism | Staphylococcus aureus subsp. aureus ST398 strain 2012-3 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | CAC37_RS10355 | Protein ID | WP_001802298.1 |
Coordinates | 2108802..2108906 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2108689..2108744 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CAC37_RS10330 | 2104828..2105493 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
CAC37_RS10335 | 2105645..2105965 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
CAC37_RS10340 | 2105967..2106947 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
CAC37_RS10345 | 2107213..2108304 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2108689..2108744 | + | 56 | - | - | Antitoxin |
CAC37_RS10355 | 2108802..2108906 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
CAC37_RS10360 | 2109586..2109744 | + | 159 | WP_001792784.1 | hypothetical protein | - |
CAC37_RS10365 | 2110180..2110272 | + | 93 | WP_000220902.1 | hypothetical protein | - |
CAC37_RS10370 | 2110402..2111259 | - | 858 | WP_000370942.1 | HAD family hydrolase | - |
CAC37_RS10375 | 2111327..2112109 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
CAC37_RS10380 | 2112399..2113007 | - | 609 | WP_000101714.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T76185 WP_001802298.1 NZ_CP021178:c2108906-2108802 [Staphylococcus aureus subsp. aureus ST398]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T76185 NZ_CP021178:c2108906-2108802 [Staphylococcus aureus subsp. aureus ST398]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT76185 NZ_CP021178:2108689-2108744 [Staphylococcus aureus subsp. aureus ST398]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|