Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2143904..2144120 | Replicon | chromosome |
Accession | NZ_CP021105 | ||
Organism | Staphylococcus aureus strain CC5 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | B4893_RS11100 | Protein ID | WP_001802298.1 |
Coordinates | 2144016..2144120 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2143904..2143959 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B4893_RS11070 | 2139739..2140404 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
B4893_RS11075 | 2140556..2140876 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
B4893_RS11080 | 2140878..2141855 | + | 978 | WP_094659716.1 | CDF family zinc efflux transporter CzrB | - |
B4893_RS11085 | 2142121..2142633 | + | 513 | Protein_2038 | transcriptional regulator | - |
B4893_RS11090 | 2142629..2142727 | - | 99 | Protein_2039 | SAM-dependent methyltransferase | - |
B4893_RS11095 | 2142876..2143583 | + | 708 | Protein_2040 | transcriptional regulator | - |
- | 2143904..2143959 | + | 56 | - | - | Antitoxin |
B4893_RS11100 | 2144016..2144120 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
B4893_RS11110 | 2144800..2144958 | + | 159 | WP_001792784.1 | hypothetical protein | - |
B4893_RS11120 | 2145616..2146473 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
B4893_RS11125 | 2146541..2147323 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T75979 WP_001802298.1 NZ_CP021105:c2144120-2144016 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T75979 NZ_CP021105:c2144120-2144016 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT75979 NZ_CP021105:2143904-2143959 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|