Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 89852..90106 | Replicon | plasmid p13P460A-2 |
Accession | NZ_CP021087 | ||
Organism | Escherichia coli strain 13P460A |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | BWI88_RS25905 | Protein ID | WP_001351576.1 |
Coordinates | 89852..90058 (-) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 90045..90106 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BWI88_RS25865 | 85094..85393 | - | 300 | Protein_84 | incFII family plasmid replication initiator RepA | - |
BWI88_RS25870 | 85480..86226 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
BWI88_RS25875 | 86241..87782 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
BWI88_RS25880 | 87974..88537 | - | 564 | Protein_87 | incFII family plasmid replication initiator RepA | - |
BWI88_RS25885 | 88530..89012 | - | 483 | WP_001273588.1 | hypothetical protein | - |
BWI88_RS25890 | 89005..89079 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
BWI88_RS25900 | 89311..89568 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
BWI88_RS25905 | 89852..90058 | - | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 90045..90106 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 90045..90106 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 90045..90106 | + | 62 | NuclAT_1 | - | Antitoxin |
- | 90045..90106 | + | 62 | NuclAT_1 | - | Antitoxin |
BWI88_RS26855 | 90362..90436 | - | 75 | Protein_92 | endonuclease | - |
BWI88_RS25915 | 90682..90894 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
BWI88_RS25920 | 91030..91590 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
BWI88_RS25925 | 91693..92553 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
BWI88_RS25930 | 92612..93358 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / tet(B) / catA1 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..169505 | 169505 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T75959 WP_001351576.1 NZ_CP021087:c90058-89852 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T75959 NZ_CP021087:c90058-89852 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT75959 NZ_CP021087:90045-90106 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|