Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 136241..136540 | Replicon | chromosome |
| Accession | NZ_CP020959 | ||
| Organism | Staphylococcus aureus strain H489 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | B9T45_RS00675 | Protein ID | WP_011447039.1 |
| Coordinates | 136364..136540 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 136241..136296 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B9T45_RS00615 | 131801..131980 | + | 180 | WP_000669791.1 | hypothetical protein | - |
| B9T45_RS00625 | 132290..132550 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| B9T45_RS00630 | 132603..132953 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| B9T45_RS00635 | 133463..133798 | - | 336 | Protein_115 | SH3 domain-containing protein | - |
| B9T45_RS00655 | 134449..134940 | - | 492 | WP_031865878.1 | staphylokinase | - |
| B9T45_RS00660 | 135131..135886 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| B9T45_RS00665 | 135898..136152 | - | 255 | WP_000611512.1 | phage holin | - |
| B9T45_RS00670 | 136204..136311 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 136233..136372 | + | 140 | NuclAT_0 | - | - |
| - | 136233..136372 | + | 140 | NuclAT_0 | - | - |
| - | 136233..136372 | + | 140 | NuclAT_0 | - | - |
| - | 136233..136372 | + | 140 | NuclAT_0 | - | - |
| - | 136241..136296 | + | 56 | - | - | Antitoxin |
| B9T45_RS00675 | 136364..136540 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| B9T45_RS00680 | 136649..137422 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| B9T45_RS00685 | 137795..138169 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| B9T45_RS00690 | 138225..138512 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| B9T45_RS00695 | 138558..138710 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | cap8D / cap8E / cap8F / cap8G / cap8L / scn / sak / sea / cap8L / cap8M | 122571..175522 | 52951 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T75801 WP_011447039.1 NZ_CP020959:c136540-136364 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T75801 NZ_CP020959:c136540-136364 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT75801 NZ_CP020959:136241-136296 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|