Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2051693..2051992 | Replicon | chromosome |
Accession | NZ_CP020956 | ||
Organism | Staphylococcus aureus strain C8879 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | B9T41_RS10665 | Protein ID | WP_072353918.1 |
Coordinates | 2051816..2051992 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2051693..2051748 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B9T41_RS10605 | 2047251..2047430 | + | 180 | WP_000669791.1 | hypothetical protein | - |
B9T41_RS10615 | 2047741..2048001 | + | 261 | WP_001791826.1 | hypothetical protein | - |
B9T41_RS10620 | 2048054..2048404 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
B9T41_RS10625 | 2048915..2049250 | - | 336 | Protein_1952 | SH3 domain-containing protein | - |
B9T41_RS10645 | 2049901..2050392 | - | 492 | WP_000920038.1 | staphylokinase | - |
B9T41_RS10650 | 2050583..2051338 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
B9T41_RS10655 | 2051350..2051604 | - | 255 | WP_000611512.1 | phage holin | - |
B9T41_RS10660 | 2051656..2051763 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2051685..2051824 | + | 140 | NuclAT_0 | - | - |
- | 2051685..2051824 | + | 140 | NuclAT_0 | - | - |
- | 2051685..2051824 | + | 140 | NuclAT_0 | - | - |
- | 2051685..2051824 | + | 140 | NuclAT_0 | - | - |
- | 2051693..2051748 | + | 56 | - | - | Antitoxin |
B9T41_RS10665 | 2051816..2051992 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
B9T41_RS10670 | 2052135..2052508 | - | 374 | Protein_1958 | hypothetical protein | - |
B9T41_RS10675 | 2052564..2052851 | - | 288 | WP_001262620.1 | hypothetical protein | - |
B9T41_RS10680 | 2052897..2053049 | - | 153 | WP_001000058.1 | hypothetical protein | - |
B9T41_RS10685 | 2053042..2056824 | - | 3783 | WP_048519605.1 | phage minor structural protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 2048054..2104098 | 56044 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T75772 WP_072353918.1 NZ_CP020956:c2051992-2051816 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T75772 NZ_CP020956:c2051992-2051816 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT75772 NZ_CP020956:2051693-2051748 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|