Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2080739..2080964 | Replicon | chromosome |
Accession | NZ_CP020753 | ||
Organism | Shigella flexneri 1c strain Y394 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | B7485_RS11085 | Protein ID | WP_000813254.1 |
Coordinates | 2080739..2080894 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2080906..2080964 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B7485_RS11020 | 2076172..2076869 | + | 698 | WP_225620329.1 | IS1 family transposase | - |
B7485_RS11025 | 2076881..2077072 | - | 192 | Protein_2121 | helix-turn-helix domain-containing protein | - |
B7485_RS11030 | 2077171..2077386 | - | 216 | WP_000839572.1 | class II holin family protein | - |
B7485_RS11060 | 2078182..2078870 | - | 689 | Protein_2123 | bacteriophage antitermination protein Q | - |
B7485_RS11065 | 2078867..2079232 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
B7485_RS11070 | 2079233..2080291 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
B7485_RS11075 | 2080293..2080571 | - | 279 | WP_011069426.1 | hypothetical protein | - |
B7485_RS11085 | 2080739..2080894 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2080906..2080964 | + | 59 | - | - | Antitoxin |
B7485_RS11100 | 2081546..2081962 | - | 417 | WP_005069274.1 | hypothetical protein | - |
B7485_RS11105 | 2081989..2082129 | + | 141 | Protein_2129 | DUF4224 domain-containing protein | - |
B7485_RS11110 | 2082129..2083179 | + | 1051 | Protein_2130 | tyrosine-type recombinase/integrase | - |
B7485_RS11120 | 2083390..2084187 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
B7485_RS11130 | 2084525..2085787 | + | 1263 | Protein_2132 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 / ipaH9.8 | 2032882..2099491 | 66609 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T75398 WP_000813254.1 NZ_CP020753:c2080894-2080739 [Shigella flexneri 1c]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T75398 NZ_CP020753:c2080894-2080739 [Shigella flexneri 1c]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT75398 NZ_CP020753:2080906-2080964 [Shigella flexneri 1c]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|