Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1396007..1396232 | Replicon | chromosome |
Accession | NZ_CP020753 | ||
Organism | Shigella flexneri 1c strain Y394 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | B7485_RS07195 | Protein ID | WP_000813254.1 |
Coordinates | 1396077..1396232 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1396007..1396065 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B7485_RS25515 | 1392005..1392174 | + | 170 | Protein_1385 | hypothetical protein | - |
B7485_RS07160 | 1392320..1393066 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
B7485_RS07165 | 1393081..1393503 | + | 423 | WP_001118167.1 | DUF977 family protein | - |
B7485_RS07170 | 1393561..1393917 | + | 357 | WP_005048249.1 | hypothetical protein | - |
B7485_RS07175 | 1394010..1394228 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
B7485_RS07180 | 1394230..1394595 | + | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
B7485_RS07185 | 1394592..1395257 | + | 666 | WP_000208062.1 | hypothetical protein | - |
B7485_RS07190 | 1395257..1395622 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
- | 1396007..1396065 | - | 59 | - | - | Antitoxin |
B7485_RS07195 | 1396077..1396232 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
B7485_RS07210 | 1397569..1398168 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
B7485_RS07215 | 1398168..1398458 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
B7485_RS07220 | 1398455..1399009 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
B7485_RS07225 | 1399150..1399335 | + | 186 | WP_005049799.1 | hypothetical protein | - |
B7485_RS07230 | 1399397..1400553 | + | 1157 | WP_134797302.1 | IS3-like element IS600 family transposase | - |
B7485_RS07235 | 1400546..1401106 | + | 561 | WP_072075205.1 | ORF6N domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 1387780..1433473 | 45693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T75385 WP_000813254.1 NZ_CP020753:1396077-1396232 [Shigella flexneri 1c]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T75385 NZ_CP020753:1396077-1396232 [Shigella flexneri 1c]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT75385 NZ_CP020753:c1396065-1396007 [Shigella flexneri 1c]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|