Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokW/Ldr(toxin)
Location 1268901..1269121 Replicon chromosome
Accession NZ_CP020753
Organism Shigella flexneri 1c strain Y394

Toxin (Protein)


Gene name ldrD Uniprot ID A0A4P7TT65
Locus tag B7485_RS06525 Protein ID WP_000170961.1
Coordinates 1268901..1269008 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 1269056..1269121 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
B7485_RS06500 (1264755) 1264755..1265837 + 1083 WP_097752582.1 peptide chain release factor 1 -
B7485_RS06505 (1265837) 1265837..1266670 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
B7485_RS06510 (1266667) 1266667..1267059 + 393 WP_000200378.1 invasion regulator SirB2 -
B7485_RS06515 (1267063) 1267063..1267862 + 800 Protein_1259 invasion regulator SirB1 -
B7485_RS06520 (1267898) 1267898..1268752 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
B7485_RS06525 (1268901) 1268901..1269008 - 108 WP_000170961.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1269056) 1269056..1269121 + 66 NuclAT_17 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_17 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_17 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_17 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_18 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_18 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_18 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_18 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_19 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_19 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_19 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_19 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_20 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_20 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_20 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_20 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_21 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_21 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_21 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_21 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_22 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_22 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_22 - Antitoxin
- (1269056) 1269056..1269121 + 66 NuclAT_22 - Antitoxin
- (1269056) 1269056..1269123 + 68 NuclAT_11 - -
- (1269056) 1269056..1269123 + 68 NuclAT_11 - -
- (1269056) 1269056..1269123 + 68 NuclAT_11 - -
- (1269056) 1269056..1269123 + 68 NuclAT_11 - -
- (1269056) 1269056..1269123 + 68 NuclAT_12 - -
- (1269056) 1269056..1269123 + 68 NuclAT_12 - -
- (1269056) 1269056..1269123 + 68 NuclAT_12 - -
- (1269056) 1269056..1269123 + 68 NuclAT_12 - -
- (1269056) 1269056..1269123 + 68 NuclAT_13 - -
- (1269056) 1269056..1269123 + 68 NuclAT_13 - -
- (1269056) 1269056..1269123 + 68 NuclAT_13 - -
- (1269056) 1269056..1269123 + 68 NuclAT_13 - -
- (1269056) 1269056..1269123 + 68 NuclAT_14 - -
- (1269056) 1269056..1269123 + 68 NuclAT_14 - -
- (1269056) 1269056..1269123 + 68 NuclAT_14 - -
- (1269056) 1269056..1269123 + 68 NuclAT_14 - -
- (1269056) 1269056..1269123 + 68 NuclAT_15 - -
- (1269056) 1269056..1269123 + 68 NuclAT_15 - -
- (1269056) 1269056..1269123 + 68 NuclAT_15 - -
- (1269056) 1269056..1269123 + 68 NuclAT_15 - -
- (1269056) 1269056..1269123 + 68 NuclAT_16 - -
- (1269056) 1269056..1269123 + 68 NuclAT_16 - -
- (1269056) 1269056..1269123 + 68 NuclAT_16 - -
- (1269056) 1269056..1269123 + 68 NuclAT_16 - -
B7485_RS06535 (1269413) 1269413..1270513 - 1101 WP_000063614.1 sodium-potassium/proton antiporter ChaA -
B7485_RS06540 (1270783) 1270783..1271013 + 231 WP_001146444.1 putative cation transport regulator ChaB -
B7485_RS06545 (1271171) 1271171..1271866 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
B7485_RS06550 (1271910) 1271910..1272263 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
B7485_RS06555 (1272448) 1272448..1273842 + 1395 WP_000086222.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T75384 WP_000170961.1 NZ_CP020753:c1269008-1268901 [Shigella flexneri 1c]
MTLAQFAMTFWHDLAAPILAGIIAAAIVSWWRNRK

Download         Length: 108 bp

>T75384 NZ_CP020753:c1269008-1268901 [Shigella flexneri 1c]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTGCCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT75384 NZ_CP020753:1269056-1269121 [Shigella flexneri 1c]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TT65

Antitoxin

Download structure file

References