Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2482290..2482474 | Replicon | chromosome |
| Accession | NZ_CP020741 | ||
| Organism | Staphylococcus aureus strain HZW450 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | B7437_RS12760 | Protein ID | WP_000482647.1 |
| Coordinates | 2482367..2482474 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2482290..2482350 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B7437_RS12740 | 2477800..2477967 | - | 168 | WP_031845053.1 | hypothetical protein | - |
| B7437_RS12750 | 2478198..2479931 | - | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein/permease | - |
| B7437_RS12755 | 2480007..2481719 | - | 1713 | WP_001064821.1 | ABC transporter ATP-binding protein/permease | - |
| B7437_RS14665 | 2482173..2482340 | - | 168 | WP_000301893.1 | hypothetical protein | - |
| - | 2482290..2482350 | + | 61 | - | - | Antitoxin |
| B7437_RS12760 | 2482367..2482474 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| B7437_RS12765 | 2482607..2482993 | - | 387 | WP_000779353.1 | flippase GtxA | - |
| B7437_RS12770 | 2483261..2484403 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| B7437_RS12775 | 2484463..2485122 | + | 660 | WP_000831298.1 | membrane protein | - |
| B7437_RS12780 | 2485305..2486516 | + | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
| B7437_RS12785 | 2486639..2487112 | - | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T75363 WP_000482647.1 NZ_CP020741:c2482474-2482367 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T75363 NZ_CP020741:c2482474-2482367 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT75363 NZ_CP020741:2482290-2482350 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|