Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1654540..1654720 | Replicon | chromosome |
Accession | NZ_CP020714 | ||
Organism | Staphylococcus aureus strain K18 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | B7474_RS14315 | Protein ID | WP_001801861.1 |
Coordinates | 1654625..1654720 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1654540..1654597 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B7474_RS08510 | 1650141..1651406 | + | 1266 | WP_000072555.1 | restriction endonuclease subunit S | - |
B7474_RS08515 | 1651445..1652299 | + | 855 | WP_001069960.1 | DNA adenine methylase | - |
B7474_RS08520 | 1652277..1653974 | + | 1698 | WP_101766563.1 | hypothetical protein | - |
- | 1654540..1654597 | + | 58 | - | - | Antitoxin |
B7474_RS14315 | 1654625..1654720 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
B7474_RS08530 | 1655171..1655617 | + | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
B7474_RS08535 | 1655801..1656357 | + | 557 | Protein_1581 | ImmA/IrrE family metallo-endopeptidase | - |
B7474_RS08540 | 1656489..1657241 | - | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
B7474_RS08545 | 1657268..1658011 | - | 744 | WP_199559051.1 | exotoxin | - |
B7474_RS08550 | 1658038..1658664 | - | 627 | WP_000669028.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 1633258..1661222 | 27964 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T75332 WP_001801861.1 NZ_CP020714:c1654720-1654625 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T75332 NZ_CP020714:c1654720-1654625 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT75332 NZ_CP020714:1654540-1654597 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|