Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1161719..1161903 | Replicon | chromosome |
Accession | NZ_CP020714 | ||
Organism | Staphylococcus aureus strain K18 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | B7474_RS05810 | Protein ID | WP_000482647.1 |
Coordinates | 1161719..1161826 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1161843..1161903 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B7474_RS05785 | 1157091..1157564 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
B7474_RS05790 | 1157687..1158898 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
B7474_RS05795 | 1159080..1159739 | - | 660 | WP_000831298.1 | membrane protein | - |
B7474_RS05800 | 1159799..1160941 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
B7474_RS05805 | 1161199..1161585 | + | 387 | WP_000779360.1 | flippase GtxA | - |
B7474_RS05810 | 1161719..1161826 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1161843..1161903 | - | 61 | - | - | Antitoxin |
B7474_RS05820 | 1162454..1164217 | + | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
B7474_RS05825 | 1164242..1165975 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
B7474_RS05835 | 1166206..1166373 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T75328 WP_000482647.1 NZ_CP020714:1161719-1161826 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T75328 NZ_CP020714:1161719-1161826 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT75328 NZ_CP020714:c1161903-1161843 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|