Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
| Location | 2556854..2557051 | Replicon | chromosome |
| Accession | NZ_CP020713 | ||
| Organism | Staphylococcus aureus strain K17 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | B7473_RS13270 | Protein ID | WP_001802298.1 |
| Coordinates | 2556947..2557051 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2556854..2556892 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B7473_RS13250 | 2553029..2553694 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| B7473_RS13250 | 2553029..2553694 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| B7473_RS13255 | 2553846..2554166 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| B7473_RS13255 | 2553846..2554166 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| B7473_RS13260 | 2554168..2555148 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
| B7473_RS13260 | 2554168..2555148 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
| B7473_RS13265 | 2555414..2556505 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
| B7473_RS13265 | 2555414..2556505 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
| - | 2556854..2556892 | + | 39 | - | - | Antitoxin |
| B7473_RS13270 | 2556947..2557051 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| B7473_RS13270 | 2556947..2557051 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| B7473_RS13280 | 2557731..2557889 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| B7473_RS13280 | 2557731..2557889 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| B7473_RS13290 | 2558547..2559404 | - | 858 | WP_000370930.1 | Cof-type HAD-IIB family hydrolase | - |
| B7473_RS13290 | 2558547..2559404 | - | 858 | WP_000370930.1 | Cof-type HAD-IIB family hydrolase | - |
| B7473_RS13295 | 2559472..2560254 | - | 783 | WP_000908180.1 | ABC transporter ATP-binding protein | - |
| B7473_RS13295 | 2559472..2560254 | - | 783 | WP_000908180.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T75324 WP_001802298.1 NZ_CP020713:c2557051-2556947 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T75324 NZ_CP020713:c2557051-2556947 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT75324 NZ_CP020713:2556854-2556892 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|