Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1011530..1011710 | Replicon | chromosome |
Accession | NZ_CP020713 | ||
Organism | Staphylococcus aureus strain K17 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | B7473_RS14285 | Protein ID | WP_001801861.1 |
Coordinates | 1011615..1011710 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1011530..1011587 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B7473_RS05230 | 1007131..1008396 | + | 1266 | WP_000072555.1 | restriction endonuclease subunit S | - |
B7473_RS05235 | 1008435..1009289 | + | 855 | WP_001069960.1 | DNA adenine methylase | - |
B7473_RS05240 | 1009267..1010964 | + | 1698 | WP_101766563.1 | hypothetical protein | - |
- | 1011530..1011587 | + | 58 | - | - | Antitoxin |
B7473_RS14285 | 1011615..1011710 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
B7473_RS05250 | 1012161..1012607 | + | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
B7473_RS05255 | 1012791..1013347 | + | 557 | Protein_998 | ImmA/IrrE family metallo-endopeptidase | - |
B7473_RS05260 | 1013479..1014231 | - | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
B7473_RS05265 | 1014258..1015001 | - | 744 | WP_199559051.1 | exotoxin | - |
B7473_RS05270 | 1015028..1015654 | - | 627 | WP_000669028.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 990248..1018211 | 27963 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T75318 WP_001801861.1 NZ_CP020713:c1011710-1011615 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T75318 NZ_CP020713:c1011710-1011615 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT75318 NZ_CP020713:1011530-1011587 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|