Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) SprA2-SprA2AS/-
Location 215281..215465 Replicon chromosome
Accession NZ_CP020713
Organism Staphylococcus aureus strain K17

Toxin (Protein)


Gene name SprA2 Uniprot ID A0A2P7CQJ7
Locus tag B7473_RS01150 Protein ID WP_000482647.1
Coordinates 215281..215388 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name SprA2AS
Locus tag -
Coordinates 215405..215465 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
B7473_RS01125 210653..211126 + 474 WP_000456489.1 GyrI-like domain-containing protein -
B7473_RS01125 210653..211126 + 474 WP_000456489.1 GyrI-like domain-containing protein -
B7473_RS01130 211249..212460 - 1212 WP_001192075.1 multidrug effflux MFS transporter -
B7473_RS01130 211249..212460 - 1212 WP_001192075.1 multidrug effflux MFS transporter -
B7473_RS01135 212642..213301 - 660 WP_000831298.1 membrane protein -
B7473_RS01135 212642..213301 - 660 WP_000831298.1 membrane protein -
B7473_RS01140 213361..214503 - 1143 WP_001176863.1 glycerate kinase -
B7473_RS01140 213361..214503 - 1143 WP_001176863.1 glycerate kinase -
B7473_RS01145 214761..215147 + 387 WP_000779360.1 flippase GtxA -
B7473_RS01145 214761..215147 + 387 WP_000779360.1 flippase GtxA -
B7473_RS01150 215281..215388 + 108 WP_000482647.1 type I toxin-antitoxin system Fst family toxin Toxin
B7473_RS01150 215281..215388 + 108 WP_000482647.1 type I toxin-antitoxin system Fst family toxin Toxin
- 215405..215465 - 61 - - Antitoxin
B7473_RS01160 216016..217779 + 1764 WP_001064816.1 ABC transporter ATP-binding protein/permease -
B7473_RS01160 216016..217779 + 1764 WP_001064816.1 ABC transporter ATP-binding protein/permease -
B7473_RS01165 217804..219537 + 1734 WP_000486494.1 ABC transporter ATP-binding protein/permease -
B7473_RS01165 217804..219537 + 1734 WP_000486494.1 ABC transporter ATP-binding protein/permease -
B7473_RS01175 219768..219935 + 168 WP_001790576.1 hypothetical protein -
B7473_RS01175 219768..219935 + 168 WP_001790576.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-100)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4012.76 Da        Isoelectric Point: 10.4935

>T75315 WP_000482647.1 NZ_CP020713:215281-215388 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK

Download         Length: 108 bp

>T75315 NZ_CP020713:215281-215388 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA

Antitoxin


Download         Length: 61 bp

>AT75315 NZ_CP020713:c215465-215405 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P7CQJ7

Antitoxin

Download structure file

References