Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2659356..2659553 | Replicon | chromosome |
Accession | NZ_CP020656 | ||
Organism | Staphylococcus aureus strain K5 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | B7R57_RS13960 | Protein ID | WP_001802298.1 |
Coordinates | 2659449..2659553 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2659356..2659394 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B7R57_RS13940 | 2655531..2656196 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
B7R57_RS13945 | 2656348..2656668 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
B7R57_RS13950 | 2656670..2657650 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
B7R57_RS13955 | 2657916..2659007 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
- | 2659356..2659394 | + | 39 | - | - | Antitoxin |
B7R57_RS13960 | 2659449..2659553 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
B7R57_RS14245 | 2660070..2660240 | + | 171 | WP_001792292.1 | transposase | - |
B7R57_RS13970 | 2660233..2660391 | + | 159 | WP_001792784.1 | hypothetical protein | - |
B7R57_RS13980 | 2661049..2661906 | - | 858 | WP_000370930.1 | Cof-type HAD-IIB family hydrolase | - |
B7R57_RS13985 | 2661974..2662756 | - | 783 | WP_000908180.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T75258 WP_001802298.1 NZ_CP020656:c2659553-2659449 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T75258 NZ_CP020656:c2659553-2659449 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT75258 NZ_CP020656:2659356-2659394 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|