Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2416923..2417103 | Replicon | chromosome |
Accession | NZ_CP020656 | ||
Organism | Staphylococcus aureus strain K5 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | B7R57_RS14240 | Protein ID | WP_001801861.1 |
Coordinates | 2417008..2417103 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2416923..2416980 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B7R57_RS12655 | 2412524..2413789 | + | 1266 | WP_000072555.1 | restriction endonuclease subunit S | - |
B7R57_RS12660 | 2413828..2414682 | + | 855 | WP_001069960.1 | DNA adenine methylase | - |
B7R57_RS12665 | 2414660..2416357 | + | 1698 | WP_101766563.1 | hypothetical protein | - |
- | 2416923..2416980 | + | 58 | - | - | Antitoxin |
B7R57_RS14240 | 2417008..2417103 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
B7R57_RS12675 | 2417554..2418000 | + | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
B7R57_RS12680 | 2418184..2418740 | + | 557 | Protein_2380 | ImmA/IrrE family metallo-endopeptidase | - |
B7R57_RS12685 | 2418872..2419624 | - | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
B7R57_RS12690 | 2419651..2420334 | - | 684 | WP_158294611.1 | exotoxin | - |
B7R57_RS12695 | 2420421..2421047 | - | 627 | WP_000669028.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 2395641..2423605 | 27964 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T75253 WP_001801861.1 NZ_CP020656:c2417103-2417008 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T75253 NZ_CP020656:c2417103-2417008 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT75253 NZ_CP020656:2416923-2416980 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|