Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1476942..1477126 | Replicon | chromosome |
Accession | NZ_CP020656 | ||
Organism | Staphylococcus aureus strain K5 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | B7R57_RS07745 | Protein ID | WP_000482647.1 |
Coordinates | 1477019..1477126 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1476942..1477002 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B7R57_RS07720 | 1472472..1472639 | - | 168 | WP_001790576.1 | hypothetical protein | - |
B7R57_RS07730 | 1472870..1474603 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
B7R57_RS07735 | 1474628..1476391 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
- | 1476942..1477002 | + | 61 | - | - | Antitoxin |
B7R57_RS07745 | 1477019..1477126 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
B7R57_RS07750 | 1477260..1477646 | - | 387 | WP_000779360.1 | flippase GtxA | - |
B7R57_RS07755 | 1477904..1479046 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
B7R57_RS07760 | 1479106..1479765 | + | 660 | WP_000831298.1 | membrane protein | - |
B7R57_RS07765 | 1479947..1481158 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
B7R57_RS07770 | 1481281..1481754 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T75248 WP_000482647.1 NZ_CP020656:c1477126-1477019 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T75248 NZ_CP020656:c1477126-1477019 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT75248 NZ_CP020656:1476942-1477002 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|