Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2091794..2092093 | Replicon | chromosome |
Accession | NZ_CP020619 | ||
Organism | Staphylococcus aureus strain JE2 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | B7H15_RS10890 | Protein ID | WP_011447039.1 |
Coordinates | 2091917..2092093 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2091794..2091849 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B7H15_RS10835 | 2087125..2087385 | + | 261 | WP_001791826.1 | hypothetical protein | - |
B7H15_RS10840 | 2087438..2087788 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
B7H15_RS10845 | 2088473..2088922 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
B7H15_RS15305 | 2089017..2089352 | - | 336 | Protein_1997 | SH3 domain-containing protein | - |
B7H15_RS10870 | 2090002..2090493 | - | 492 | WP_000919350.1 | staphylokinase | - |
B7H15_RS10875 | 2090684..2091439 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
B7H15_RS10880 | 2091451..2091705 | - | 255 | WP_000611512.1 | phage holin | - |
B7H15_RS10885 | 2091757..2091864 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2091786..2091925 | + | 140 | NuclAT_0 | - | - |
- | 2091786..2091925 | + | 140 | NuclAT_0 | - | - |
- | 2091786..2091925 | + | 140 | NuclAT_0 | - | - |
- | 2091786..2091925 | + | 140 | NuclAT_0 | - | - |
- | 2091794..2091849 | + | 56 | - | - | Antitoxin |
B7H15_RS10890 | 2091917..2092093 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
B7H15_RS10895 | 2092243..2092539 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
B7H15_RS10900 | 2092597..2092884 | - | 288 | WP_001040261.1 | hypothetical protein | - |
B7H15_RS10905 | 2092931..2093083 | - | 153 | WP_001153681.1 | hypothetical protein | - |
B7H15_RS10910 | 2093073..2096858 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | map / hlb / scn / chp / sak / hlb / groEL | 2083622..2146406 | 62784 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T75192 WP_011447039.1 NZ_CP020619:c2092093-2091917 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T75192 NZ_CP020619:c2092093-2091917 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT75192 NZ_CP020619:2091794-2091849 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|