Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3860984..3861206 | Replicon | chromosome |
Accession | NZ_CP020545 | ||
Organism | Escherichia coli strain ZJ3920 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | B6V57_RS28500 | Protein ID | WP_001295224.1 |
Coordinates | 3860984..3861091 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3861140..3861206 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B6V57_RS20100 | 3856519..3856707 | - | 189 | WP_001063314.1 | YhjR family protein | - |
B6V57_RS20105 | 3856980..3858551 | + | 1572 | WP_001204957.1 | cellulose biosynthesis protein BcsE | - |
B6V57_RS20110 | 3858548..3858739 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
B6V57_RS20115 | 3858736..3860415 | + | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
B6V57_RS20120 | 3860501..3860608 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
B6V57_RS28500 | 3860984..3861091 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 3861140..3861206 | + | 67 | - | - | Antitoxin |
B6V57_RS20140 | 3861466..3861573 | - | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
B6V57_RS20150 | 3862049..3863320 | + | 1272 | WP_001332306.1 | amino acid permease | - |
B6V57_RS20155 | 3863350..3864354 | - | 1005 | WP_148123951.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
B6V57_RS20160 | 3864351..3865334 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T75105 WP_001295224.1 NZ_CP020545:c3861091-3860984 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T75105 NZ_CP020545:c3861091-3860984 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCACGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCACGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT75105 NZ_CP020545:3861140-3861206 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|