Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2248547..2248772 | Replicon | chromosome |
Accession | NZ_CP020528 | ||
Organism | Enterobacter cloacae strain 174 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A8S7B7V6 |
Locus tag | AXJ76_RS11475 | Protein ID | WP_000813256.1 |
Coordinates | 2248617..2248772 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2248547..2248605 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AXJ76_RS11440 | 2243959..2244378 | - | 420 | WP_000362155.1 | hypothetical protein | - |
AXJ76_RS11445 | 2244479..2244760 | + | 282 | WP_000391950.1 | helix-turn-helix domain-containing protein | - |
AXJ76_RS11450 | 2244744..2245169 | + | 426 | WP_000693832.1 | hypothetical protein | - |
AXJ76_RS11455 | 2245241..2246311 | + | 1071 | WP_021536266.1 | hypothetical protein | - |
AXJ76_RS11460 | 2246352..2246777 | + | 426 | WP_001151208.1 | DUF977 family protein | - |
AXJ76_RS11465 | 2247005..2248030 | + | 1026 | WP_000379313.1 | hypothetical protein | - |
- | 2248547..2248605 | - | 59 | - | - | Antitoxin |
AXJ76_RS11475 | 2248617..2248772 | + | 156 | WP_000813256.1 | type I toxin-antitoxin system toxin HokD | Toxin |
AXJ76_RS11480 | 2249231..2249509 | + | 279 | WP_086532009.1 | hypothetical protein | - |
AXJ76_RS11485 | 2249511..2250560 | + | 1050 | WP_001265033.1 | DUF968 domain-containing protein | - |
AXJ76_RS11490 | 2250573..2250947 | + | 375 | WP_021536265.1 | RusA family crossover junction endodeoxyribonuclease | - |
AXJ76_RS11495 | 2250944..2251765 | + | 822 | WP_045350650.1 | antitermination protein | - |
AXJ76_RS11515 | 2252661..2252792 | + | 132 | WP_000562553.1 | DUF3927 family protein | - |
AXJ76_RS11525 | 2253159..2253587 | + | 429 | WP_000506933.1 | cell envelope integrity protein TolA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2237895..2274069 | 36174 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5764.94 Da Isoelectric Point: 6.1531
>T75030 WP_000813256.1 NZ_CP020528:2248617-2248772 [Enterobacter cloacae]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTVYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTVYEPEE
Download Length: 156 bp
>T75030 NZ_CP020528:2248617-2248772 [Enterobacter cloacae]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGTCTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGTCTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT75030 NZ_CP020528:c2248605-2248547 [Enterobacter cloacae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|