Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 103641..103881 | Replicon | plasmid unnamed1 |
Accession | NZ_CP020519 | ||
Organism | Escherichia coli strain 222 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | A9P13_RS28505 | Protein ID | WP_001312861.1 |
Coordinates | 103641..103799 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 103843..103881 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A9P13_RS28480 | 99149..99970 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
A9P13_RS28485 | 100089..100376 | - | 288 | WP_000107535.1 | hypothetical protein | - |
A9P13_RS29035 | 100401..100607 | - | 207 | WP_024190427.1 | hypothetical protein | - |
A9P13_RS28500 | 101579..103246 | + | 1668 | WP_012372796.1 | group II intron reverse transcriptase/maturase | - |
A9P13_RS28505 | 103641..103799 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 103843..103881 | - | 39 | NuclAT_1 | - | Antitoxin |
- | 103843..103881 | - | 39 | NuclAT_1 | - | Antitoxin |
- | 103843..103881 | - | 39 | NuclAT_1 | - | Antitoxin |
- | 103843..103881 | - | 39 | NuclAT_1 | - | Antitoxin |
- | 105321..105423 | - | 103 | NuclAT_0 | - | - |
- | 105321..105423 | - | 103 | NuclAT_0 | - | - |
- | 105321..105423 | - | 103 | NuclAT_0 | - | - |
- | 105321..105423 | - | 103 | NuclAT_0 | - | - |
A9P13_RS28515 | 105435..106154 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
A9P13_RS28520 | 106151..106585 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
A9P13_RS28525 | 106640..108598 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / dfrA17 / aadA5 / qacE / sul1 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IId | - | 1..120667 | 120667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T74982 WP_001312861.1 NZ_CP020519:c103799-103641 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T74982 NZ_CP020519:c103799-103641 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGAGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGAGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 39 bp
>AT74982 NZ_CP020519:c103881-103843 [Escherichia coli]
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|