Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 48482..48746 | Replicon | plasmid unnamed2 |
Accession | NZ_CP020511 | ||
Organism | Escherichia coli strain 165 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | AWB10_RS27670 | Protein ID | WP_001387489.1 |
Coordinates | 48482..48634 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 48686..48746 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AWB10_RS27645 | 43748..45916 | + | 2169 | WP_015508354.1 | DotA/TraY family protein | - |
AWB10_RS27650 | 45987..46649 | + | 663 | WP_012783935.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
AWB10_RS27655 | 46721..46930 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
AWB10_RS29120 | 47322..47498 | + | 177 | WP_001054900.1 | hypothetical protein | - |
AWB10_RS27660 | 47563..47859 | - | 297 | WP_011264046.1 | hypothetical protein | - |
AWB10_RS27665 | 48159..48410 | + | 252 | WP_001291964.1 | hypothetical protein | - |
AWB10_RS27670 | 48482..48634 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
- | 48686..48746 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 48686..48746 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 48686..48746 | + | 61 | NuclAT_0 | - | Antitoxin |
- | 48686..48746 | + | 61 | NuclAT_0 | - | Antitoxin |
AWB10_RS27675 | 48949..50040 | + | 1092 | WP_000426061.1 | hypothetical protein | - |
- | 50110..50167 | + | 58 | NuclAT_1 | - | - |
- | 50110..50167 | + | 58 | NuclAT_1 | - | - |
- | 50110..50167 | + | 58 | NuclAT_1 | - | - |
- | 50110..50167 | + | 58 | NuclAT_1 | - | - |
AWB10_RS27680 | 50347..51555 | + | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
AWB10_RS27685 | 51574..52644 | + | 1071 | WP_012783932.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..85008 | 85008 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T74894 WP_001387489.1 NZ_CP020511:c48634-48482 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T74894 NZ_CP020511:c48634-48482 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT74894 NZ_CP020511:48686-48746 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|