Detailed information of TA system TA074891

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 65628..65897
• Replicon: plasmid unnamed1
• Accession: NZ_CP020510
• Organism: Escherichia coli strain 165

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: AWB10_RS27035
• Protein ID: WP_034169443.1
• Coordinates: 65739..65897 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	65628..65693 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AWB10_RS28835	60655..60924	+	270	WP_074015062.1	hypothetical protein	-
AWB10_RS29090	61165..61371	+	207	WP_000547971.1	hypothetical protein	-
AWB10_RS27010	61397..61936	+	540	WP_009426937.1	single-stranded DNA-binding protein	-
AWB10_RS27015	61998..62231	+	234	WP_000006030.1	DUF905 family protein	-
AWB10_RS27020	62296..64254	+	1959	WP_072652246.1	ParB/RepB/Spo0J family partition protein	-
AWB10_RS27025	64309..64743	+	435	WP_032217500.1	conjugation system SOS inhibitor PsiB	-
AWB10_RS27030	64740..65459	+	720	WP_050858785.1	plasmid SOS inhibition protein A	-
AWB10_RS28840	65471..65659	-	189	WP_001299721.1	hypothetical protein	-
-	65471..65695	+	225	NuclAT_0	-	-
-	65471..65695	+	225	NuclAT_0	-	-
-	65471..65695	+	225	NuclAT_0	-	-
-	65471..65695	+	225	NuclAT_0	-	-
-	65628..65693	+	66	-	-	Antitoxin
AWB10_RS27035	65739..65897	+	159	WP_034169443.1	type I toxin-antitoxin system Hok family toxin	Toxin
AWB10_RS29095	66588..66794	+	207	WP_000547971.1	hypothetical protein	-
AWB10_RS27055	66819..67106	+	288	WP_000107535.1	hypothetical protein	-
AWB10_RS27060	67224..68045	+	822	WP_001234469.1	DUF945 domain-containing protein	-
AWB10_RS27065	68342..68989	-	648	WP_000614935.1	transglycosylase SLT domain-containing protein	-
AWB10_RS27070	69266..69649	+	384	WP_000124981.1	relaxosome protein TraM	-
AWB10_RS27075	69840..70526	+	687	WP_001825184.1	PAS domain-containing protein	-
AWB10_RS27080	70620..70847	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / aac(3)-IId / rmtB / sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / tet(A)	-	1..118182	118182

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T74891 WP_034169443.1 NZ_CP020510:65739-65897 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCELRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

>T74891 NZ_CP020510:65739-65897 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGCTTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT74891 NZ_CP020510:65628-65693 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin