Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 93842..94081 | Replicon | plasmid unnamed1 |
Accession | NZ_CP020496 | ||
Organism | Escherichia coli strain 103 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | CPA47_RS26070 | Protein ID | WP_023144756.1 |
Coordinates | 93842..93976 (-) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 94021..94081 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CPA47_RS26045 | 89080..89154 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
CPA47_RS26890 | 89151..89285 | - | 135 | Protein_96 | protein CopA/IncA | - |
CPA47_RS26050 | 89411..90624 | + | 1214 | WP_162829202.1 | IS3 family transposase | - |
CPA47_RS26055 | 90829..92370 | + | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
CPA47_RS26060 | 92385..93131 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
CPA47_RS26065 | 93291..93545 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
CPA47_RS26070 | 93842..93976 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 94021..94081 | + | 61 | NuclAT_2 | - | Antitoxin |
- | 94021..94081 | + | 61 | NuclAT_2 | - | Antitoxin |
- | 94021..94081 | + | 61 | NuclAT_2 | - | Antitoxin |
- | 94021..94081 | + | 61 | NuclAT_2 | - | Antitoxin |
CPA47_RS26805 | 94048..94334 | - | 287 | Protein_102 | DUF2726 domain-containing protein | - |
CPA47_RS26085 | 94847..95059 | - | 213 | WP_013023861.1 | hypothetical protein | - |
CPA47_RS26090 | 95190..95750 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
CPA47_RS26095 | 95805..96551 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
CPA47_RS26100 | 96571..99027 | - | 2457 | Protein_106 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / dfrA17 / aadA5 / qacE / sul1 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IId | - | 1..120668 | 120668 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T74793 WP_023144756.1 NZ_CP020496:c93976-93842 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T74793 NZ_CP020496:c93976-93842 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT74793 NZ_CP020496:94021-94081 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|