Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1560..1800 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP020496 | ||
| Organism | Escherichia coli strain 103 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | CPA47_RS25515 | Protein ID | WP_001312861.1 |
| Coordinates | 1560..1718 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 1762..1800 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CPA47_RS25515 | 1560..1718 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 1762..1800 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 1762..1800 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 1762..1800 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 1762..1800 | - | 39 | NuclAT_1 | - | Antitoxin |
| - | 3240..3342 | - | 103 | NuclAT_0 | - | - |
| - | 3240..3342 | - | 103 | NuclAT_0 | - | - |
| - | 3240..3342 | - | 103 | NuclAT_0 | - | - |
| - | 3240..3342 | - | 103 | NuclAT_0 | - | - |
| CPA47_RS25525 | 3354..4073 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| CPA47_RS25530 | 4070..4504 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| CPA47_RS25535 | 4559..6517 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / dfrA17 / aadA5 / qacE / sul1 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IId | - | 1..120668 | 120668 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T74786 WP_001312861.1 NZ_CP020496:c1718-1560 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T74786 NZ_CP020496:c1718-1560 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGAGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGAGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 39 bp
>AT74786 NZ_CP020496:c1800-1762 [Escherichia coli]
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|