Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2235875..2236096 Replicon chromosome
Accession NZ_CP020495
Organism Escherichia coli strain 103

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag CPA47_RS11075 Protein ID WP_000176713.1
Coordinates 2235875..2235982 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2236030..2236096 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CPA47_RS11040 2231009..2232091 + 1083 WP_000804726.1 peptide chain release factor 1 -
CPA47_RS11045 2232091..2232924 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
CPA47_RS11050 2232921..2233313 + 393 WP_000200377.1 invasion regulator SirB2 -
CPA47_RS11055 2233317..2234126 + 810 WP_001257044.1 invasion regulator SirB1 -
CPA47_RS11060 2234162..2235016 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CPA47_RS11070 2235211..2235669 + 459 WP_000526135.1 IS200/IS605 family transposase -
CPA47_RS11075 2235875..2235982 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2236030..2236096 + 67 NuclAT_21 - Antitoxin
- 2236030..2236096 + 67 NuclAT_21 - Antitoxin
- 2236030..2236096 + 67 NuclAT_21 - Antitoxin
- 2236030..2236096 + 67 NuclAT_21 - Antitoxin
- 2236030..2236096 + 67 NuclAT_26 - Antitoxin
- 2236030..2236096 + 67 NuclAT_26 - Antitoxin
- 2236030..2236096 + 67 NuclAT_26 - Antitoxin
- 2236030..2236096 + 67 NuclAT_26 - Antitoxin
- 2236030..2236096 + 67 NuclAT_31 - Antitoxin
- 2236030..2236096 + 67 NuclAT_31 - Antitoxin
- 2236030..2236096 + 67 NuclAT_31 - Antitoxin
- 2236030..2236096 + 67 NuclAT_31 - Antitoxin
- 2236030..2236096 + 67 NuclAT_36 - Antitoxin
- 2236030..2236096 + 67 NuclAT_36 - Antitoxin
- 2236030..2236096 + 67 NuclAT_36 - Antitoxin
- 2236030..2236096 + 67 NuclAT_36 - Antitoxin
- 2236030..2236096 + 67 NuclAT_38 - Antitoxin
- 2236030..2236096 + 67 NuclAT_38 - Antitoxin
- 2236030..2236096 + 67 NuclAT_38 - Antitoxin
- 2236030..2236096 + 67 NuclAT_38 - Antitoxin
- 2236030..2236096 + 67 NuclAT_43 - Antitoxin
- 2236030..2236096 + 67 NuclAT_43 - Antitoxin
- 2236030..2236096 + 67 NuclAT_43 - Antitoxin
- 2236030..2236096 + 67 NuclAT_43 - Antitoxin
- 2236032..2236095 + 64 NuclAT_46 - -
- 2236032..2236095 + 64 NuclAT_46 - -
- 2236032..2236095 + 64 NuclAT_46 - -
- 2236032..2236095 + 64 NuclAT_46 - -
- 2236032..2236095 + 64 NuclAT_48 - -
- 2236032..2236095 + 64 NuclAT_48 - -
- 2236032..2236095 + 64 NuclAT_48 - -
- 2236032..2236095 + 64 NuclAT_48 - -
CPA47_RS11080 2236410..2236517 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2236570..2236631 + 62 NuclAT_45 - -
- 2236570..2236631 + 62 NuclAT_45 - -
- 2236570..2236631 + 62 NuclAT_45 - -
- 2236570..2236631 + 62 NuclAT_45 - -
- 2236570..2236631 + 62 NuclAT_47 - -
- 2236570..2236631 + 62 NuclAT_47 - -
- 2236570..2236631 + 62 NuclAT_47 - -
- 2236570..2236631 + 62 NuclAT_47 - -
- 2236570..2236632 + 63 NuclAT_22 - -
- 2236570..2236632 + 63 NuclAT_22 - -
- 2236570..2236632 + 63 NuclAT_22 - -
- 2236570..2236632 + 63 NuclAT_22 - -
- 2236570..2236632 + 63 NuclAT_27 - -
- 2236570..2236632 + 63 NuclAT_27 - -
- 2236570..2236632 + 63 NuclAT_27 - -
- 2236570..2236632 + 63 NuclAT_27 - -
- 2236570..2236632 + 63 NuclAT_32 - -
- 2236570..2236632 + 63 NuclAT_32 - -
- 2236570..2236632 + 63 NuclAT_32 - -
- 2236570..2236632 + 63 NuclAT_32 - -
- 2236570..2236632 + 63 NuclAT_37 - -
- 2236570..2236632 + 63 NuclAT_37 - -
- 2236570..2236632 + 63 NuclAT_37 - -
- 2236570..2236632 + 63 NuclAT_37 - -
- 2236570..2236632 + 63 NuclAT_39 - -
- 2236570..2236632 + 63 NuclAT_39 - -
- 2236570..2236632 + 63 NuclAT_39 - -
- 2236570..2236632 + 63 NuclAT_39 - -
- 2236570..2236632 + 63 NuclAT_44 - -
- 2236570..2236632 + 63 NuclAT_44 - -
- 2236570..2236632 + 63 NuclAT_44 - -
- 2236570..2236632 + 63 NuclAT_44 - -
CPA47_RS11085 2236923..2238023 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
CPA47_RS11090 2238293..2238523 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CPA47_RS11095 2238681..2239376 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
CPA47_RS11100 2239420..2239773 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2235211..2235669 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T74757 WP_000176713.1 NZ_CP020495:c2235982-2235875 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T74757 NZ_CP020495:c2235982-2235875 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT74757 NZ_CP020495:2236030-2236096 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References