Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1913227..1913407 | Replicon | chromosome |
| Accession | NZ_CP020467 | ||
| Organism | Staphylococcus aureus strain CFSAN007896 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | AB477_RS09510 | Protein ID | WP_001801861.1 |
| Coordinates | 1913227..1913322 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1913350..1913407 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB477_RS09470 | 1908370..1908996 | + | 627 | WP_000669038.1 | hypothetical protein | - |
| AB477_RS09475 | 1909037..1909381 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
| AB477_RS09480 | 1909479..1910051 | + | 573 | WP_000414222.1 | hypothetical protein | - |
| AB477_RS09485 | 1910200..1911141 | - | 942 | WP_001794355.1 | FRG domain-containing protein | - |
| AB477_RS09490 | 1911158..1911568 | - | 411 | WP_107375236.1 | hypothetical protein | - |
| AB477_RS09495 | 1911568..1912137 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AB477_RS09500 | 1912330..1912776 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| AB477_RS09510 | 1913227..1913322 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1913350..1913407 | - | 58 | - | - | Antitoxin |
| AB477_RS09515 | 1913445..1913546 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| AB477_RS09520 | 1913721..1914164 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
| AB477_RS09525 | 1914164..1914607 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| AB477_RS09530 | 1914607..1915049 | - | 443 | Protein_1802 | DUF1433 domain-containing protein | - |
| AB477_RS09535 | 1915574..1917994 | + | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T74714 WP_001801861.1 NZ_CP020467:1913227-1913322 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T74714 NZ_CP020467:1913227-1913322 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT74714 NZ_CP020467:c1913407-1913350 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|