Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1239497..1239717 Replicon chromosome
Accession NZ_CP020368
Organism Escherichia coli strain BLR(DE3)

Toxin (Protein)


Gene name ldrD Uniprot ID E3PKK3
Locus tag B5762_RS06505 Protein ID WP_000170951.1
Coordinates 1239497..1239604 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1239654..1239717 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
B5762_RS06480 1235343..1236425 + 1083 WP_000804726.1 peptide chain release factor 1 -
B5762_RS06485 1236425..1237258 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
B5762_RS06490 1237255..1237647 + 393 WP_000200373.1 invasion regulator SirB2 -
B5762_RS06495 1237651..1238460 + 810 WP_001257044.1 invasion regulator SirB1 -
B5762_RS06500 1238496..1239350 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
B5762_RS06505 1239497..1239604 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1239654..1239717 + 64 NuclAT_32 - Antitoxin
- 1239654..1239717 + 64 NuclAT_32 - Antitoxin
- 1239654..1239717 + 64 NuclAT_32 - Antitoxin
- 1239654..1239717 + 64 NuclAT_32 - Antitoxin
- 1239654..1239717 + 64 NuclAT_35 - Antitoxin
- 1239654..1239717 + 64 NuclAT_35 - Antitoxin
- 1239654..1239717 + 64 NuclAT_35 - Antitoxin
- 1239654..1239717 + 64 NuclAT_35 - Antitoxin
- 1239654..1239717 + 64 NuclAT_38 - Antitoxin
- 1239654..1239717 + 64 NuclAT_38 - Antitoxin
- 1239654..1239717 + 64 NuclAT_38 - Antitoxin
- 1239654..1239717 + 64 NuclAT_38 - Antitoxin
- 1239654..1239717 + 64 NuclAT_41 - Antitoxin
- 1239654..1239717 + 64 NuclAT_41 - Antitoxin
- 1239654..1239717 + 64 NuclAT_41 - Antitoxin
- 1239654..1239717 + 64 NuclAT_41 - Antitoxin
- 1239654..1239717 + 64 NuclAT_47 - Antitoxin
- 1239654..1239717 + 64 NuclAT_47 - Antitoxin
- 1239654..1239717 + 64 NuclAT_47 - Antitoxin
- 1239654..1239717 + 64 NuclAT_47 - Antitoxin
- 1239654..1239717 + 64 NuclAT_50 - Antitoxin
- 1239654..1239717 + 64 NuclAT_50 - Antitoxin
- 1239654..1239717 + 64 NuclAT_50 - Antitoxin
- 1239654..1239717 + 64 NuclAT_50 - Antitoxin
B5762_RS06515 1240032..1240139 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1240187..1240252 + 66 NuclAT_30 - -
- 1240187..1240252 + 66 NuclAT_30 - -
- 1240187..1240252 + 66 NuclAT_30 - -
- 1240187..1240252 + 66 NuclAT_30 - -
- 1240187..1240252 + 66 NuclAT_33 - -
- 1240187..1240252 + 66 NuclAT_33 - -
- 1240187..1240252 + 66 NuclAT_33 - -
- 1240187..1240252 + 66 NuclAT_33 - -
- 1240187..1240252 + 66 NuclAT_36 - -
- 1240187..1240252 + 66 NuclAT_36 - -
- 1240187..1240252 + 66 NuclAT_36 - -
- 1240187..1240252 + 66 NuclAT_36 - -
- 1240187..1240252 + 66 NuclAT_39 - -
- 1240187..1240252 + 66 NuclAT_39 - -
- 1240187..1240252 + 66 NuclAT_39 - -
- 1240187..1240252 + 66 NuclAT_39 - -
- 1240187..1240252 + 66 NuclAT_45 - -
- 1240187..1240252 + 66 NuclAT_45 - -
- 1240187..1240252 + 66 NuclAT_45 - -
- 1240187..1240252 + 66 NuclAT_45 - -
- 1240187..1240252 + 66 NuclAT_48 - -
- 1240187..1240252 + 66 NuclAT_48 - -
- 1240187..1240252 + 66 NuclAT_48 - -
- 1240187..1240252 + 66 NuclAT_48 - -
- 1240187..1240254 + 68 NuclAT_16 - -
- 1240187..1240254 + 68 NuclAT_16 - -
- 1240187..1240254 + 68 NuclAT_16 - -
- 1240187..1240254 + 68 NuclAT_16 - -
- 1240187..1240254 + 68 NuclAT_18 - -
- 1240187..1240254 + 68 NuclAT_18 - -
- 1240187..1240254 + 68 NuclAT_18 - -
- 1240187..1240254 + 68 NuclAT_18 - -
- 1240187..1240254 + 68 NuclAT_20 - -
- 1240187..1240254 + 68 NuclAT_20 - -
- 1240187..1240254 + 68 NuclAT_20 - -
- 1240187..1240254 + 68 NuclAT_20 - -
- 1240187..1240254 + 68 NuclAT_22 - -
- 1240187..1240254 + 68 NuclAT_22 - -
- 1240187..1240254 + 68 NuclAT_22 - -
- 1240187..1240254 + 68 NuclAT_22 - -
- 1240187..1240254 + 68 NuclAT_24 - -
- 1240187..1240254 + 68 NuclAT_24 - -
- 1240187..1240254 + 68 NuclAT_24 - -
- 1240187..1240254 + 68 NuclAT_24 - -
- 1240187..1240254 + 68 NuclAT_26 - -
- 1240187..1240254 + 68 NuclAT_26 - -
- 1240187..1240254 + 68 NuclAT_26 - -
- 1240187..1240254 + 68 NuclAT_26 - -
B5762_RS06525 1240567..1240674 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1240722..1240787 + 66 NuclAT_31 - -
- 1240722..1240787 + 66 NuclAT_31 - -
- 1240722..1240787 + 66 NuclAT_31 - -
- 1240722..1240787 + 66 NuclAT_31 - -
- 1240722..1240787 + 66 NuclAT_34 - -
- 1240722..1240787 + 66 NuclAT_34 - -
- 1240722..1240787 + 66 NuclAT_34 - -
- 1240722..1240787 + 66 NuclAT_34 - -
- 1240722..1240787 + 66 NuclAT_37 - -
- 1240722..1240787 + 66 NuclAT_37 - -
- 1240722..1240787 + 66 NuclAT_37 - -
- 1240722..1240787 + 66 NuclAT_37 - -
- 1240722..1240787 + 66 NuclAT_40 - -
- 1240722..1240787 + 66 NuclAT_40 - -
- 1240722..1240787 + 66 NuclAT_40 - -
- 1240722..1240787 + 66 NuclAT_40 - -
- 1240722..1240787 + 66 NuclAT_46 - -
- 1240722..1240787 + 66 NuclAT_46 - -
- 1240722..1240787 + 66 NuclAT_46 - -
- 1240722..1240787 + 66 NuclAT_46 - -
- 1240722..1240787 + 66 NuclAT_49 - -
- 1240722..1240787 + 66 NuclAT_49 - -
- 1240722..1240787 + 66 NuclAT_49 - -
- 1240722..1240787 + 66 NuclAT_49 - -
- 1240722..1240789 + 68 NuclAT_15 - -
- 1240722..1240789 + 68 NuclAT_15 - -
- 1240722..1240789 + 68 NuclAT_15 - -
- 1240722..1240789 + 68 NuclAT_15 - -
- 1240722..1240789 + 68 NuclAT_17 - -
- 1240722..1240789 + 68 NuclAT_17 - -
- 1240722..1240789 + 68 NuclAT_17 - -
- 1240722..1240789 + 68 NuclAT_17 - -
- 1240722..1240789 + 68 NuclAT_19 - -
- 1240722..1240789 + 68 NuclAT_19 - -
- 1240722..1240789 + 68 NuclAT_19 - -
- 1240722..1240789 + 68 NuclAT_19 - -
- 1240722..1240789 + 68 NuclAT_21 - -
- 1240722..1240789 + 68 NuclAT_21 - -
- 1240722..1240789 + 68 NuclAT_21 - -
- 1240722..1240789 + 68 NuclAT_21 - -
- 1240722..1240789 + 68 NuclAT_23 - -
- 1240722..1240789 + 68 NuclAT_23 - -
- 1240722..1240789 + 68 NuclAT_23 - -
- 1240722..1240789 + 68 NuclAT_23 - -
- 1240722..1240789 + 68 NuclAT_25 - -
- 1240722..1240789 + 68 NuclAT_25 - -
- 1240722..1240789 + 68 NuclAT_25 - -
- 1240722..1240789 + 68 NuclAT_25 - -
B5762_RS06535 1241079..1242179 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
B5762_RS06540 1242449..1242679 + 231 WP_001146444.1 putative cation transport regulator ChaB -
B5762_RS06545 1242837..1243532 + 696 WP_012775986.1 glutathione-specific gamma-glutamylcyclotransferase -
B5762_RS06550 1243576..1243929 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3961.74 Da        Isoelectric Point: 9.1413

>T74416 WP_000170951.1 NZ_CP020368:c1239604-1239497 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T74416 NZ_CP020368:c1239604-1239497 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT74416 NZ_CP020368:1239654-1239717 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E3PKK3

Antitoxin

Download structure file

References