Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2118123..2118320 | Replicon | chromosome |
Accession | NZ_CP020354 | ||
Organism | Staphylococcus aureus strain FORC59 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | FORC59_RS10820 | Protein ID | WP_001802298.1 |
Coordinates | 2118216..2118320 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2118123..2118161 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC59_RS10800 | 2114298..2114963 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
FORC59_RS10805 | 2115115..2115435 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
FORC59_RS10810 | 2115437..2116417 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
FORC59_RS10815 | 2116683..2117774 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
- | 2118123..2118161 | + | 39 | - | - | Antitoxin |
FORC59_RS10820 | 2118216..2118320 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
FORC59_RS10830 | 2119000..2119158 | + | 159 | WP_001792784.1 | hypothetical protein | - |
FORC59_RS10840 | 2119816..2120673 | - | 858 | WP_000370928.1 | Cof-type HAD-IIB family hydrolase | - |
FORC59_RS10845 | 2120741..2121523 | - | 783 | WP_000908189.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T74364 WP_001802298.1 NZ_CP020354:c2118320-2118216 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T74364 NZ_CP020354:c2118320-2118216 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT74364 NZ_CP020354:2118123-2118161 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|