Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3567487..3567712 | Replicon | chromosome |
Accession | NZ_CP020342 | ||
Organism | Shigella flexneri 1a strain 0439 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | BS647_RS19270 | Protein ID | WP_000813254.1 |
Coordinates | 3567487..3567642 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3567654..3567712 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BS647_RS19225 | 3562630..3563112 | - | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
BS647_RS19230 | 3563183..3564322 | - | 1140 | WP_000088354.1 | IS3 family transposase | - |
BS647_RS19235 | 3564384..3564557 | - | 174 | WP_000504450.1 | hypothetical protein | - |
BS647_RS19240 | 3564710..3565264 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
BS647_RS19245 | 3565261..3565551 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
BS647_RS19250 | 3565551..3566150 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
BS647_RS19260 | 3566284..3566981 | + | 698 | WP_223368647.1 | IS1 family transposase | - |
BS647_RS19270 | 3567487..3567642 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3567654..3567712 | + | 59 | - | - | Antitoxin |
BS647_RS19280 | 3568097..3568462 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
BS647_RS19285 | 3568462..3569127 | - | 666 | WP_000208062.1 | hypothetical protein | - |
BS647_RS19290 | 3569124..3569489 | - | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
BS647_RS19295 | 3569491..3569709 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
BS647_RS19300 | 3569802..3570158 | - | 357 | WP_005048249.1 | hypothetical protein | - |
BS647_RS19305 | 3570216..3570638 | - | 423 | WP_001118168.1 | DUF977 family protein | - |
BS647_RS19310 | 3570653..3571399 | - | 747 | WP_000788996.1 | ATP-binding protein | - |
BS647_RS28515 | 3571545..3571714 | - | 170 | Protein_3486 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 3516279..3580744 | 64465 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T74324 WP_000813254.1 NZ_CP020342:c3567642-3567487 [Shigella flexneri 1a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T74324 NZ_CP020342:c3567642-3567487 [Shigella flexneri 1a]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT74324 NZ_CP020342:3567654-3567712 [Shigella flexneri 1a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|