Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2891966..2892191 | Replicon | chromosome |
Accession | NZ_CP020342 | ||
Organism | Shigella flexneri 1a strain 0439 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | BS647_RS15230 | Protein ID | WP_000813254.1 |
Coordinates | 2892036..2892191 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2891966..2892024 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BS647_RS15185 | 2887143..2888405 | - | 1263 | Protein_2748 | tyrosine-type recombinase/integrase | - |
BS647_RS15195 | 2888743..2889540 | - | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
BS647_RS15205 | 2889751..2890801 | - | 1051 | Protein_2750 | tyrosine-type recombinase/integrase | - |
BS647_RS15210 | 2890801..2890941 | - | 141 | Protein_2751 | DUF4224 domain-containing protein | - |
BS647_RS15215 | 2890968..2891384 | + | 417 | WP_005069274.1 | hypothetical protein | - |
- | 2891966..2892024 | - | 59 | - | - | Antitoxin |
BS647_RS15230 | 2892036..2892191 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
BS647_RS15240 | 2892359..2892637 | + | 279 | WP_011069426.1 | hypothetical protein | - |
BS647_RS15245 | 2892639..2893697 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
BS647_RS15250 | 2893698..2894063 | + | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
BS647_RS15255 | 2894060..2894748 | + | 689 | Protein_2757 | bacteriophage antitermination protein Q | - |
BS647_RS15285 | 2895544..2895759 | + | 216 | WP_000839572.1 | class II holin family protein | - |
BS647_RS15290 | 2895858..2896532 | + | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
BS647_RS15295 | 2896529..2896879 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 2884376..2924818 | 40442 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T74313 WP_000813254.1 NZ_CP020342:2892036-2892191 [Shigella flexneri 1a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T74313 NZ_CP020342:2892036-2892191 [Shigella flexneri 1a]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT74313 NZ_CP020342:c2892024-2891966 [Shigella flexneri 1a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|