Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1393876..1394101 | Replicon | chromosome |
| Accession | NZ_CP020339 | ||
| Organism | Shigella flexneri 4c strain 0702 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | BS653_RS08025 | Protein ID | WP_000813254.1 |
| Coordinates | 1393876..1394031 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1394043..1394101 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BS653_RS07960 | 1389188..1389538 | - | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| BS653_RS07965 | 1389535..1390209 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
| BS653_RS07970 | 1390308..1390523 | - | 216 | WP_000839572.1 | class II holin family protein | - |
| BS653_RS08000 | 1391319..1392007 | - | 689 | Protein_1459 | bacteriophage antitermination protein Q | - |
| BS653_RS08005 | 1392004..1392369 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BS653_RS08010 | 1392370..1393428 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| BS653_RS08015 | 1393430..1393708 | - | 279 | WP_011069426.1 | hypothetical protein | - |
| BS653_RS08025 | 1393876..1394031 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 1394043..1394101 | + | 59 | - | - | Antitoxin |
| BS653_RS08040 | 1394683..1395099 | - | 417 | WP_005069274.1 | hypothetical protein | - |
| BS653_RS08045 | 1395126..1395266 | + | 141 | Protein_1465 | DUF4224 domain-containing protein | - |
| BS653_RS08050 | 1395266..1396316 | + | 1051 | Protein_1466 | tyrosine-type recombinase/integrase | - |
| BS653_RS08060 | 1396527..1397324 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
| BS653_RS08070 | 1397662..1398924 | + | 1263 | Protein_1468 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 1362027..1421087 | 59060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T74298 WP_000813254.1 NZ_CP020339:c1394031-1393876 [Shigella flexneri 4c]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T74298 NZ_CP020339:c1394031-1393876 [Shigella flexneri 4c]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT74298 NZ_CP020339:1394043-1394101 [Shigella flexneri 4c]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|