Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 726003..726228 | Replicon | chromosome |
| Accession | NZ_CP020339 | ||
| Organism | Shigella flexneri 4c strain 0702 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | BS653_RS04045 | Protein ID | WP_000813254.1 |
| Coordinates | 726073..726228 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 726003..726061 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BS653_RS27360 | 722001..722170 | + | 170 | Protein_739 | hypothetical protein | - |
| BS653_RS04005 | 722316..723062 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
| BS653_RS04010 | 723077..723499 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
| BS653_RS04015 | 723557..723913 | + | 357 | WP_005048249.1 | hypothetical protein | - |
| BS653_RS04020 | 724006..724224 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
| BS653_RS04025 | 724226..724591 | + | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
| BS653_RS04030 | 724588..725253 | + | 666 | WP_000208062.1 | hypothetical protein | - |
| BS653_RS04035 | 725253..725618 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| - | 726003..726061 | - | 59 | - | - | Antitoxin |
| BS653_RS04045 | 726073..726228 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| BS653_RS04065 | 727565..728164 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
| BS653_RS04070 | 728164..728454 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| BS653_RS04075 | 728451..729005 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
| BS653_RS04080 | 729158..729331 | + | 174 | WP_000504450.1 | hypothetical protein | - |
| BS653_RS04085 | 729393..730532 | + | 1140 | WP_000088353.1 | IS3 family transposase | - |
| BS653_RS04090 | 730603..731085 | + | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 712971..767148 | 54177 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T74287 WP_000813254.1 NZ_CP020339:726073-726228 [Shigella flexneri 4c]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T74287 NZ_CP020339:726073-726228 [Shigella flexneri 4c]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT74287 NZ_CP020339:c726061-726003 [Shigella flexneri 4c]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|