Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2222506..2222731 | Replicon | chromosome |
Accession | NZ_CP020336 | ||
Organism | Shigella flexneri 4c strain 1602 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | BS654_RS12515 | Protein ID | WP_000813254.1 |
Coordinates | 2222506..2222661 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2222673..2222731 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BS654_RS12450 | 2217818..2218168 | - | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
BS654_RS12455 | 2218165..2218839 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
BS654_RS12460 | 2218938..2219153 | - | 216 | WP_000839572.1 | class II holin family protein | - |
BS654_RS12490 | 2219949..2220637 | - | 689 | Protein_2281 | bacteriophage antitermination protein Q | - |
BS654_RS12495 | 2220634..2220999 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
BS654_RS12500 | 2221000..2222058 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
BS654_RS12505 | 2222060..2222338 | - | 279 | WP_011069426.1 | hypothetical protein | - |
BS654_RS12515 | 2222506..2222661 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2222673..2222731 | + | 59 | - | - | Antitoxin |
BS654_RS12530 | 2223313..2223729 | - | 417 | WP_005069274.1 | hypothetical protein | - |
BS654_RS12535 | 2223756..2223896 | + | 141 | Protein_2287 | DUF4224 domain-containing protein | - |
BS654_RS12540 | 2223896..2224946 | + | 1051 | Protein_2288 | tyrosine-type recombinase/integrase | - |
BS654_RS12550 | 2225157..2225954 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
BS654_RS12560 | 2226292..2227554 | + | 1263 | Protein_2290 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 2205106..2249718 | 44612 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T74275 WP_000813254.1 NZ_CP020336:c2222661-2222506 [Shigella flexneri 4c]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T74275 NZ_CP020336:c2222661-2222506 [Shigella flexneri 4c]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT74275 NZ_CP020336:2222673-2222731 [Shigella flexneri 4c]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|