Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1548828..1549053 | Replicon | chromosome |
| Accession | NZ_CP020336 | ||
| Organism | Shigella flexneri 4c strain 1602 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | BS654_RS08485 | Protein ID | WP_000813254.1 |
| Coordinates | 1548898..1549053 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1548828..1548886 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BS654_RS28890 | 1544826..1544995 | + | 170 | Protein_1555 | hypothetical protein | - |
| BS654_RS08445 | 1545141..1545887 | + | 747 | WP_094085497.1 | ATP-binding protein | - |
| BS654_RS08450 | 1545902..1546324 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
| BS654_RS08455 | 1546382..1546738 | + | 357 | WP_005048249.1 | hypothetical protein | - |
| BS654_RS08460 | 1546831..1547049 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
| BS654_RS08465 | 1547051..1547416 | + | 366 | Protein_1560 | HNH endonuclease | - |
| BS654_RS08470 | 1547413..1548078 | + | 666 | WP_000208062.1 | hypothetical protein | - |
| BS654_RS08475 | 1548078..1548443 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| - | 1548828..1548886 | - | 59 | - | - | Antitoxin |
| BS654_RS08485 | 1548898..1549053 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| BS654_RS08505 | 1550390..1550989 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
| BS654_RS08510 | 1550989..1551279 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| BS654_RS08515 | 1551276..1551830 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
| BS654_RS08520 | 1551983..1552156 | + | 174 | WP_000504450.1 | hypothetical protein | - |
| BS654_RS08525 | 1552218..1553357 | + | 1140 | WP_000088353.1 | IS3 family transposase | - |
| BS654_RS08530 | 1553428..1553910 | + | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 1540911..1605036 | 64125 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T74264 WP_000813254.1 NZ_CP020336:1548898-1549053 [Shigella flexneri 4c]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T74264 NZ_CP020336:1548898-1549053 [Shigella flexneri 4c]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT74264 NZ_CP020336:c1548886-1548828 [Shigella flexneri 4c]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|