Detailed information of TA system TA074209

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 34889..35128
• Replicon: plasmid unitig_5
• Accession: NZ_CP020117
• Organism: Escherichia coli strain AR_0104

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: AM483_RS26000
• Protein ID: WP_023144756.1
• Coordinates: 34994..35128 (+)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	34889..34949 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AM483_RS25965	30101..30847	+	747	WP_000205718.1	conjugal transfer pilus acetylase TraX	-
AM483_RS25970	30902..31462	+	561	WP_000139341.1	fertility inhibition protein FinO	-
AM483_RS25975	31593..31805	+	213	WP_013023861.1	hypothetical protein	-
AM483_RS25980	32142..32567	+	426	WP_000422741.1	IS66 family insertion sequence hypothetical protein	-
AM483_RS25985	32564..32914	+	351	WP_000624722.1	IS66 family insertion sequence element accessory protein TnpB	-
AM483_RS25990	32945..34558	+	1614	WP_000080195.1	IS66-like element ISEc23 family transposase	-
AM483_RS25995	34636..34922	+	287	Protein_36	DUF2726 domain-containing protein	-
-	34889..34949	-	61	NuclAT_2	-	Antitoxin
-	34889..34949	-	61	NuclAT_2	-	Antitoxin
-	34889..34949	-	61	NuclAT_2	-	Antitoxin
-	34889..34949	-	61	NuclAT_2	-	Antitoxin
AM483_RS26000	34994..35128	+	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
AM483_RS26005	35425..35679	+	255	WP_000083850.1	replication regulatory protein RepA	-
AM483_RS28535	35785..35919	+	135	Protein_39	protein CopA/IncA	-
AM483_RS26015	35916..35990	+	75	WP_031943482.1	RepA leader peptide Tap	-
AM483_RS26020	35983..36840	+	858	WP_001617855.1	incFII family plasmid replication initiator RepA	-
AM483_RS26030	37780..38433	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
AM483_RS28345	38526..38783	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
AM483_RS26035	38716..39117	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5	senB	1..107210	107210

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T74209 WP_023144756.1 NZ_CP020117:34994-35128 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

>T74209 NZ_CP020117:34994-35128 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA

Antitoxin

Nucleotide

• Length: 61 bp

>AT74209 NZ_CP020117:c34949-34889 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin