Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 8319..8561 | Replicon | plasmid unitig_5 |
Accession | NZ_CP020117 | ||
Organism | Escherichia coli strain AR_0104 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | AM483_RS25845 | Protein ID | WP_001312861.1 |
Coordinates | 8403..8561 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 8319..8359 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AM483_RS25820 | 3514..5472 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
AM483_RS25825 | 5527..5961 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
AM483_RS25830 | 5958..6677 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
- | 6689..6875 | + | 187 | NuclAT_0 | - | - |
- | 6689..6875 | + | 187 | NuclAT_0 | - | - |
- | 6689..6875 | + | 187 | NuclAT_0 | - | - |
- | 6689..6875 | + | 187 | NuclAT_0 | - | - |
AM483_RS25840 | 6923..8292 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
- | 8319..8359 | + | 41 | NuclAT_1 | - | Antitoxin |
- | 8319..8359 | + | 41 | NuclAT_1 | - | Antitoxin |
- | 8319..8359 | + | 41 | NuclAT_1 | - | Antitoxin |
- | 8319..8359 | + | 41 | NuclAT_1 | - | Antitoxin |
AM483_RS25845 | 8403..8561 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
AM483_RS28530 | 9252..9458 | + | 207 | WP_000275859.1 | hypothetical protein | - |
AM483_RS25870 | 9483..9770 | + | 288 | WP_000107535.1 | hypothetical protein | - |
AM483_RS25875 | 9889..10710 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
AM483_RS25880 | 11007..11609 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
AM483_RS25885 | 11940..12323 | + | 384 | WP_001151566.1 | relaxosome protein TraM | - |
AM483_RS25890 | 12457..13134 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
AM483_RS25895 | 13222..13443 | + | 222 | WP_072277695.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 | senB | 1..107210 | 107210 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T74205 WP_001312861.1 NZ_CP020117:8403-8561 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T74205 NZ_CP020117:8403-8561 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT74205 NZ_CP020117:8319-8359 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|