Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2963507..2963732 | Replicon | chromosome |
Accession | NZ_CP020086 | ||
Organism | Shigella flexneri 1a strain 0670 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | B4376_RS16030 | Protein ID | WP_000813254.1 |
Coordinates | 2963507..2963662 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2963674..2963732 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B4376_RS15985 | 2958650..2959132 | - | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
B4376_RS15990 | 2959203..2960342 | - | 1140 | WP_000088354.1 | IS3 family transposase | - |
B4376_RS15995 | 2960404..2960577 | - | 174 | WP_000504450.1 | hypothetical protein | - |
B4376_RS16000 | 2960730..2961284 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
B4376_RS16005 | 2961281..2961571 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
B4376_RS16010 | 2961571..2962170 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
B4376_RS16020 | 2962304..2963001 | + | 698 | WP_225620329.1 | IS1 family transposase | - |
B4376_RS16030 | 2963507..2963662 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2963674..2963732 | + | 59 | - | - | Antitoxin |
B4376_RS16040 | 2964117..2964482 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
B4376_RS16045 | 2964482..2965147 | - | 666 | WP_000208062.1 | hypothetical protein | - |
B4376_RS16050 | 2965144..2965509 | - | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
B4376_RS16055 | 2965511..2965729 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
B4376_RS16060 | 2965822..2966178 | - | 357 | WP_005048249.1 | hypothetical protein | - |
B4376_RS16065 | 2966236..2966658 | - | 423 | WP_001118167.1 | DUF977 family protein | - |
B4376_RS16070 | 2966673..2967419 | - | 747 | WP_000788996.1 | ATP-binding protein | - |
B4376_RS28410 | 2967565..2967734 | - | 170 | Protein_2874 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 2905647..2976764 | 71117 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T74016 WP_000813254.1 NZ_CP020086:c2963662-2963507 [Shigella flexneri 1a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T74016 NZ_CP020086:c2963662-2963507 [Shigella flexneri 1a]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT74016 NZ_CP020086:2963674-2963732 [Shigella flexneri 1a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|