Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2436687..2436912 | Replicon | chromosome |
Accession | NZ_CP020086 | ||
Organism | Shigella flexneri 1a strain 0670 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | B4376_RS12900 | Protein ID | WP_000813254.1 |
Coordinates | 2436687..2436842 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2436854..2436912 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B4376_RS12835 | 2431999..2432349 | - | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
B4376_RS12840 | 2432346..2433020 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
B4376_RS12845 | 2433119..2433334 | - | 216 | WP_000839572.1 | class II holin family protein | - |
B4376_RS12875 | 2434130..2434818 | - | 689 | Protein_2313 | bacteriophage antitermination protein Q | - |
B4376_RS12880 | 2434815..2435180 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
B4376_RS12885 | 2435181..2436239 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
B4376_RS12890 | 2436241..2436519 | - | 279 | WP_011069426.1 | hypothetical protein | - |
B4376_RS12900 | 2436687..2436842 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2436854..2436912 | + | 59 | - | - | Antitoxin |
B4376_RS12915 | 2437494..2437910 | - | 417 | WP_005069274.1 | hypothetical protein | - |
B4376_RS12920 | 2437937..2438077 | + | 141 | Protein_2319 | DUF4224 domain-containing protein | - |
B4376_RS12925 | 2438077..2439127 | + | 1051 | Protein_2320 | tyrosine-type recombinase/integrase | - |
B4376_RS12935 | 2439338..2440135 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
B4376_RS12945 | 2440473..2441735 | + | 1263 | Protein_2322 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | ipaH9.8 | 2407557..2464896 | 57339 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T74005 WP_000813254.1 NZ_CP020086:c2436842-2436687 [Shigella flexneri 1a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T74005 NZ_CP020086:c2436842-2436687 [Shigella flexneri 1a]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT74005 NZ_CP020086:2436854-2436912 [Shigella flexneri 1a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|