Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-timR/Ldr(toxin) |
| Location | 1971061..1971282 | Replicon | chromosome |
| Accession | NZ_CP020025 | ||
| Organism | Escherichia coli strain WB61 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A1D7PZ30 |
| Locus tag | B1T56_RS10010 | Protein ID | WP_022645587.1 |
| Coordinates | 1971061..1971168 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | timR | ||
| Locus tag | - | ||
| Coordinates | 1971216..1971282 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B1T56_RS09985 | 1966905..1967987 | + | 1083 | WP_022645584.1 | peptide chain release factor 1 | - |
| B1T56_RS09990 | 1967987..1968820 | + | 834 | WP_022645585.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| B1T56_RS09995 | 1968817..1969209 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| B1T56_RS10000 | 1969213..1970022 | + | 810 | WP_022645586.1 | invasion regulator SirB1 | - |
| B1T56_RS10005 | 1970058..1970912 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| B1T56_RS10010 | 1971061..1971168 | - | 108 | WP_022645587.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1971216..1971282 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_12 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1971216..1971282 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 1971220..1971281 | + | 62 | NuclAT_22 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_22 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_22 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_22 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_23 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_23 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_23 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_23 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_24 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_24 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_24 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_24 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_25 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_25 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_25 | - | - |
| - | 1971220..1971281 | + | 62 | NuclAT_25 | - | - |
| B1T56_RS10015 | 1971573..1972673 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
| B1T56_RS10020 | 1972943..1973173 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| B1T56_RS10025 | 1973331..1974026 | + | 696 | WP_012311798.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| B1T56_RS10030 | 1974070..1974423 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
| B1T56_RS10035 | 1974608..1976002 | + | 1395 | WP_022645588.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4029.82 Da Isoelectric Point: 11.4779
>T73799 WP_022645587.1 NZ_CP020025:c1971168-1971061 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK
Download Length: 108 bp
>T73799 NZ_CP020025:c1971168-1971061 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT73799 NZ_CP020025:1971216-1971282 [Escherichia coli]
GTTGTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTC
GTTGTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
